« Back
Home /
Rabbit Anti-Rat beta endorphin

Rabbit Anti-Rat beta endorphin

Manufacturer	Raybiotech
Category	Antibodies Primary Antibodies
Type	Antibody Polyclonal
Specific against	Rat
Clone	Polyclonal
Isotype	IgG
Amount	50ul
Host	Rabbit
Item no.	114-10216
eClass 6.1	32160702
eClass 9.0	32160702
Available
Target Name	beta endorphin
Target Synonyms	beta endorphin, Proopiomelanocortin, LPH, ACTH, MSH, POMC, beta endorfin, Alpha MSH, ACTH
Application notes:	Immunohistochemistry
Product Description	beta endorphin, antibody, rabbit, 50 ul.
Immunogen	YGGFMTSKSQTPLVTLFKNAIIKNAYKKGE

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.