Comparison

Rabbit Anti-Rat beta endorphin

Manufacturer Raybiotech
Category
Type Antibody Polyclonal
Specific against Rat
Clone Polyclonal
Isotype IgG
Amount 50ul
Host Rabbit
Item no. 114-10216
Approximate Leadtime 2-3 Weeks
eClass 6.1 32160702
eClass 9.0 32160702
Available
Target Name
beta endorphin
Target Synonyms
beta endorphin, Proopiomelanocortin, LPH, ACTH, MSH, POMC, beta endorfin, Alpha MSH, ACTH
Application notes:
Immunohistochemistry
Product Description
beta endorphin, antibody, rabbit, 50 ul.
Immunogen
YGGFMTSKSQTPLVTLFKNAIIKNAYKKGE

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

Amount: 50ul
Available: In stock
available

Compare

Add to wishlist

Request delivery time

Ask a technical question

Submit a bulk request

Questions about this Product?
 
Close