« Back
Home /
Macrophage Migration Inhibitory Factor, Human Recombinant (Active)

Macrophage Migration Inhibitory Factor, Human Recombinant (Active)

Item no.	228-11106-3
Manufacturer	Raybiotech
Amount	1 mg
Quantity options	3 x 10 ug 1 mg
Category	Oncology Neuroscience Neuroinflammation Metabolism Diabetes Peptides & Proteins Recombinant Proteins By Organ Lung Cancer Colorectal Cancer Breast Cancer
Type	Proteins Recombinant
Format	Lyophilized
Specific against	Human (Homo sapiens)
Host	E.coli
Purity	Greater than 97.0% as determined by:(a) Analysis by RP-HPLC. (b) Analysis by SDS-PAGE.
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Similar products	MIF, Active
Shipping Condition	Room temperature
Available
Manufacturer - Category	Proteins\|Recombinant Proteins\|Human Proteins\|Enzymes & Inhibitors
Shipping Temperature	Ambient temperature
Storage Conditions	-20°C
UNSPSC Code	12352202
Formulation	MIF-Protein was lyophilized from 10mM sodium phosphate buffer pH-7.5.
Expressed Region	MPMFIVNTNVPRASVPDGFLSELTQQLAQATGKPPQYIAVHVVPDQLMAFGGSSEPCALCSLHSIGKIGGAQNRSYSKLLCGLLAERLRISPDRVYINYYDMNAANVGWNNSTFA.
Protein Name & Synonyms	Phenylpyruvate tautomerase, Glycosylation-inhibiting factor, GIF, MMIF, MIF.
Reconstitution	It is recommended to reconstitute the lyophilized MIF-Protein in sterile 18MΩ-cm H2O at a concentration between 0.1mg-1mg per 1ml.
Biological activity	Human PBMCs were cultured with 0 to 1000ng/ml Human MIF. Production of IL-8 was measured via ELISA after 24 hours. The ED50 which was found to be 88-132ng/ml.

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

228-11106-3.pdf

228-11106-3-datasheet.pdf

Request safety datasheet

Simple Order Order Subscription

Amount: 1 mg

available

Delivery expected until 12/11/2025

Express Delivery: Save 3 days

Compare

Add to wishlist

Get an offer