Mouse Anti-Human PPARD

Human PPARD monoclonal antibody (100 ug)

$412.00  
101-11297
+

Antigen Information

Accession Number:
  • AAH02715
Gene ID:
  • 5467
Gene Symbols:
  • PPARD
Protein Name & Synonyms:
PPARD
Target Species:
  • Human

Antibody Specifications

Applications:
Proximity Ligation Analysis, ELISA, WB
Host Species:
Mouse
Immunogen Sequence:
MEQPQEEAPEVREEEEKEEVAEAEGAPELNGGPQHALPSS SYTDLSRSSSPPSLLDQLQMGCDGASCGSLNMECRVCGDK ASGFHYGVHACEGCKGFFRRTIRMKLEYEKCERSCKIQKK NRNKCQYCRFQKCLALGMSHNAIRFGRMPEAEKRKLVAGL TANEGSQYNPQVADLKAFSKHIYNAYLKNFNMTKKKARSI LTGKASHTAPFVIHDIETLWQAEKGLVWKQLVNGLPPYKE ISVHVFYRCQCTTVETVRELTEFAKSIPSFSSLFLNDQVT LLKYGVHEAIFAMLASIVNKDGLLVANGSGFVTREFLRSL RKPFSDIIEPKFEFAVKFNALELDDSDLALFIAAIILCGG E
Species Reactivity:
Human
Clonality:
Monoclonal
Isotype:
IgG1 Kappa

Synonyms

FAAR, MGC3931, NR1C2, NUC1, NUCI, NUCII, PPAR-beta, PPARB

Description

Mouse monoclonal antibody raised against a full length recombinant PPARD.

Source

Specificity
Human

Gene Information

Gene Accession #
BC002715

Preparation

Storage Buffer
1x PBS, pH 7.2

Western Blot detection against Immunogen (65.45 KDa).
PPARD monoclonal antibody 1B11 Western Blot analysis of PPARD expression in Jurkat .
Proximity Ligation Analysis of protein-protein interactions between HDAC2 and PPARD HeLa cells were stained with anti-HDAC2 rabbit purified polyclonal 1:1200 and anti-PPARD mouse monoclonal antibody 1:50. Each red dot represents the detection of protein-protein interaction complex, and nuclei were counterstained with DAPI (blue).
Detection limit for recombinant GST tagged PPARD is approximately 0.03ng/ml as a capture antibody.

Storage

Storage Recommendations
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.

No posts found

Write A Review
U.S. Non-U.S.

Usage

This product is furnished for LABORATORY RESEARCH USE ONLY.
Not for diagnostic or therapeutic use.

Recently Viewed Recently Viewed