Mouse Anti-Human TLX3

Human TLX3 monoclonal antibody (100 ug)

$412.00  
101-11801
+

Antigen Information

Accession Number:
  • NP_066305
Gene ID:
  • 30012
Gene Symbols:
  • TLX3
Protein Name & Synonyms:
TLX3
Target Species:
  • Human

Antibody Specifications

Applications:
WB, ELISA
Host Species:
Mouse
Immunogen Sequence:
ASAERAALAKSLKMTDAQVKTWFQNRRTKWRRQTAEEREA ERQQASRLMLQLQHDAFQKSLNDSIQPDPLCLHNSSLFAL QNLQPWEEDSSKVPAVTSLV
Species Reactivity:
Human
Clonality:
Monoclonal
Isotype:
IgG1 Kappa

Synonyms

HOX11L2, MGC29804, RNX

Description

Mouse monoclonal antibody raised against a partial recombinant TLX3.

Source

Specificity
Human

Gene Information

Gene Accession #
NM_021025

Preparation

Storage Buffer
1x PBS, pH 7.2

Western Blot detection against Immunogen (36.74 KDa).
Western blot analysis of TLX3 over-expressed 293 cell line, cotransfected with TLX3 Validated Chimera RNAi (Lane 2) or non-transfected control (Lane 1). Blot probed with TLX3 monoclonal antibody. GAPDH ( 36.1 kDa ) used as specificity and loading control.
TLX3 monoclonal antibody Western Blot analysis of TLX3 expression in MCF-7 .
Western Blot analysis of TLX3 expression in transfected 293T cell line by TLX3 monoclonal antibody. Lane 1: TLX3 transfected lysate(31.9 KDa). Lane 2: Non-transfected lysate.
Detection limit for recombinant GST tagged TLX3 is approximately 0.03ng/ml as a capture antibody.

Storage

Storage Recommendations
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.

No posts found

Write A Review
U.S. Non-U.S.

Usage

This product is furnished for LABORATORY RESEARCH USE ONLY.
Not for diagnostic or therapeutic use.

Recently Viewed Recently Viewed