Mouse Anti-Human TRAF2

Human TRAF2 monoclonal antibody (100 ug)

$412.00  
101-11832
+

Antigen Information

Accession Number:
  • AAH43492
Gene ID:
  • 7186
Gene Symbols:
  • TRAF2
Protein Name & Synonyms:
TRAF2
Target Species:
  • Human

Antibody Specifications

Applications:
WB, Proximity Ligation Analysis, ELISA
Host Species:
Mouse
Immunogen Sequence:
MAAASVTPPGSLELLQPGFSKTLLGTKLEAKYLCSACRNV LRRPFQAQCGHRYCSFCLASILSSGPQNCAACVHEGIYEE GISILESSSAFPDNAARREVESLPAVCPSDGCTWKGTLKE YESCHEGRCPLMLTECPACKGLVRLGEKERHLEHECPERS LSCRHCRAPCCGADVKAHHEVCPKFPLTCDGCGKKKIPRE KFQDHVKTCGKCRVPCRFHAIGCLETVEGEKQQEHEVQWL REHLAMLLSSVLEAKPLLGDQSHAGSELLQRCESLEKKTA TFENIVCVLNREVERVAMTAEACSRQHRLDQDKIEALSSK VQQLERSIGLKDLAMADLEQKVLEMEASTYDGVFIWKISD FARKRQEAVAGRIPAIFSPAFYTSRYGYKMCLRIYLNGDG TGRGTHLSLFFVVMKGPNDALLRWPFNQKVTLMLLDQNNR EHVIDAFRPDVTSSSFQRPVNDMNIASGCPLFCPVSKMEA KNSYVRDDAIFIKAIVDLTGL
Species Reactivity:
Human
Clonality:
Monoclonal
Isotype:
IgG2a Kappa

Synonyms

MGC:45012, TRAP, TRAP3

Description

Mouse monoclonal antibody raised against a full-length recombinant TRAF2.

Source

Specificity
Human

Gene Information

Gene Accession #
BC043492

Preparation

Storage Buffer
1x PBS, pH 7.2

Western Blot detection against Immunogen (80.85 KDa).
Western Blot analysis of TRAF2 expression in transfected 293T cell line by TRAF2 monoclonal antibody . Lane 1: TRAF2 transfected lysate(55.9 KDa). Lane 2: Non-transfected lysate.
Proximity Ligation Analysis of protein-protein interactions between IKBKB and TRAF2 HeLa cells were stained with anti-IKBKB rabbit purified polyclonal 1:1200 and anti-TRAF2 mouse monoclonal antibody 1:50. Each red dot represents the detection of protein-protein interaction complex, and nuclei were counterstained with DAPI (blue).

Storage

Storage Recommendations
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.

No posts found

Write A Review
U.S. Non-U.S.

Usage

This product is furnished for LABORATORY RESEARCH USE ONLY.
Not for diagnostic or therapeutic use.

Recently Viewed Recently Viewed