Vergleich

Recombinant Human TNF beta/TNFb/TNFSF1B Protein Europäischer Partner

ArtNr RP00506-10ug
Hersteller Abclonal
Menge 10 ug
Quantity options 1000 ug 10 ug 500 ug 50 ug
Kategorie
Typ Proteins Recombinant
Specific against Human (Homo sapiens)
Host Human
Purity > 95% by SDS-PAGE.
Sequence LPGVGLTPSAAQTARQHPKMHLAHSTLKPAAHLIGDPSKQNSLLWRANTDRAFLQDGFSLSNNSLLVPTSGIYFVYSQVVFSGKAYSPKATSSPLYLAHEVQLFSSQYPFHVPLLSSQKMVYPGLQEPWLHSMYHGAAFQLTQGDQLSTHTDGIPHLVLSPSTVFFGAFAL
NCBI TNF-beta/LT-alpha
ECLASS 10.1 32160409
ECLASS 11.0 32160409
UNSPSC 12352202
Alias Lymphotoxin-Alpha,LT-Alpha,TNF-Beta,Tumor Necrosis Factor Ligand Superfamily Member 1,LTA,TNFB,TNFSF1
Similar products LTA, TNFB, TNFSF1, Tumor Necrosis Factor Ligand Superfamily Member 1, Lymphotoxin-Alpha, LT-Alpha, TNF-Beta
Lieferbar
Manufacturer - Category
Proteins
Storage Conditions
Store the lyophilized protein at -20°C to -80 °C for long term.
After reconstitution, the protein solution is stable at -20 °C for 3 months, at 2-8 °C for up to 1 week.
Description
Centrifuge the tube before opening. Reconstitute to a concentration of 0.1-0.5 mg/mL in sterile distilled water. Avoid votex or vigorously pipetting the protein. For long term storage, it is recommended to add a carrier protein or stablizer (e.g. 0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose), and aliquot the reconstituted protein solution to minimize free-thaw cycles.
Background
Tumor Necrosis Factor β (TNF- β ) is a secreted protein belonging to the tumor necrosis factor family. TNF- βbinds to TNFRSF1A/TNFR1, TNFRSF1B/TNFBR and TNFRSF14/HVEM in homotrimeric form, binds toTNFRSF3/LTBR in heterotrimeric form with LTB. TNF- β forms heterotrimers with lymphotoxin-beta, whichanchors TNF- β to the cell surface. TNF- β mediates the inflammatory, immunostimulatory, and antiviralresponse, involves in the formation of second lymphoid organs during development, has a role in apoptosis.TNF-β is produced by lymphocytes and cytotoxic for a variety of tumor cells in vitro and in vivo.
Immunogen
Leu35-Leu205
Route
No tag
Endotoxin
< 1 EU/μg of the protein by LAL method.
Manufacturer - Research Area
TNF family, Biosimilar Drug Targets
Protein Formulation
Lyophilized from a 0.2 μm filtered solution of 20mM PB, 150mM NaCl, pH 7.4.Contact us for customized product form or formulation.

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Menge: 10 ug
Lieferbar: In stock
lieferbar

Vergleichen

Auf den Wunschzettel

Angebot anfordern

Lieferzeit anfragen

Technische Frage stellen

Bulk-Anfrage stellen

Fragen zum Produkt?
 
Schließen