Recombinant Human Interleukin-12p40

Recombinant human Interleukin-12 p40 is a glycosylated polypeptide chain containing 312 amino acids ( fragment 23 - 328 P29460 IL12B_HUMAN) with an amino- terminal hexahistidine tag. The recombinant protein has a predicted molecular mass of 35.5kDa, however as a result of potential glycosylation, the molecular mass could be approximately 40kDa by SDSPAGE under reducing conditions.

5, 91

P29460

Human recombinant protein expressed in Nicotiana benthamiana. It is produced by transient expression in non-transgenic plants. This product contains no animal–derived components or impurities. Animal Free product.

HHHHHHIWELKKDVYVVELDWYPDAPGEMVVLTCD TPEEDGITWTLDQSSEVLGSGKTLTIQVKEFGDAG QYTCHKGGEVLSHSLLLLHKKEDGIWSTDILKDQK EPKNKTFLRCEAKNYSGRFTCWWLTTISTDLTFSV KSSRGSSDPQGVTCGAATLSAERVRGDNKEYEYSV ECQEDSACPAAEESLPIEVMVDAVHKLKYENYTSS FFIRDIIKPDPPKNLQLKPLKNSRQVEVSWEYPDT WSTPHSYFSLTFCVQVQGKSKREKKDRVFTDKTSA TVICRKNASISVRAQDRYYSSSWSEWASVPCS

Purity >97% by SDS-PAGE gel

The biological activity of IL12 p40 is determined by the dose dependent inhibition of IL-12 dependent IFN-gamma production (mouse splenocytes). - Not available.

-

-Gee K, et al. (2009) The IL-12 family of cytokines in infection, inflammation and autoimmune disorders. , Mars 8(1):40-52. -Trinchieri, G. (1998) Interleukin 12: a cytokine at the interface of inflame and immunity. Adv. Immunolog., 70: 83-243 -Gillessen, S. et al. (1995) Mouse interleukine-12 (IL-12)p40 homodimer: a potent IL-12 antagonist. Eur. Immunolog, 25:200-206. -Gately, M. K., et al. (1998) The inteleukine-12/interleukine-12 receptor system: role in normal and pathologic immune responses. Annu. Rev. Immunol, 16:495-521 -D'Andrea, A. et al. (1992) Production of natural killer cell stimulatory factor (interleukin 12) by peripheral blood mononuclear cells. J. Exp. Med., 176: 1387-1398. -Chan, S. H. et al. (1991). Induction of interferon gamma production by natural killer cell stimulatory factor: characterization of the responder cells and synergy with other inducers. J. Exp Med., 173:869-879 -Wolf, S. F. et al. (1991) Cloning of cDNA for natural killer cell stimulatory factor, a heterodimeric cytokine with multiple biologic effects on T and natural killer cells. J. Immunol., 146: 3074-3081.

This lyophilized preparation is stable at 2-8C C for short term, long storage it should be kept at -20C. Reconstituted protein should be stored in working aliquots at –20C. Repeated freezing and thawing is not recommended.

1ug, 5ug, 10ug, 20ug, 100ug