Vergleich

Active Recombinant Human Interleukin-6 Europäischer Partner

ArtNr RF0032-10
Hersteller Agrenvec
Menge 10ug
Kategorie
Typ Proteins Recombinant
Specific against other
ECLASS 10.1 32160409
ECLASS 11.0 32160409
UNSPSC 12352202
Alias Interleukin 6 (interferon, beta 2)
Lieferbar
Molecular Weight:
Recombinant human Interleukin-6 is a polypeptide chain containing 183 amino acids (30 – 212 of P05231 IL6_HUMAN) and 10 aa Histidine-based tag. It as a predicted molecular mass of 22.2 kDa, however as result of potential glycosylation, the recombinant protein could migrate with an apparent molecular mass of 23-24 kDa in SDS-PAGE gel.
Molecular Formula:
C969H1545N283O296S9
p.I:
6, 93
Ext. Coeff. Abs (280nm) 0.1% (=1g/l) =
0, 46
UniProtKB:
P05231
Endotoxin level:
Endotoxin Level : < 0.04 EU / ug protein (LAL method)
Source:
Human recombinant protein expressed in Nicotiana benthamiana. It is produced by transient expression in non-transgenic plants. This product contains no animal–derived components or impurities. Animal Free product.
Description:
Recombinant human Interleukin-6 is an important pro-inflammatory and anti-inflammatory cytokine expressed by many types cell including: T and B cells, macrophages, endothelial cells, fibroblasts, monocytes, keratinocytes and certain tumour cells. It is a multifunctional cytokine that modulates several physiologic processes such as haematopoiesis, stimulation of immunoglobulin synthesis, maturation and activation of B cells, differentiation of T lymphocytes and regulation of the hepatic acute-phase response. IL-6 is also produced in muscle, is discharged into the bloodstream after muscle contraction and acts increasing the breakdown of fats and improving insulin resistance. IL-6 induces signalling through a cell surface heterodimeric receptor complex composed of a ligand binding subunit (IL-6 R) and a signal transducing subunit (gp130). IL-6 binds to IL-6 R, triggering IL-6 R association with gp130 and gp130 dimerization. Soluble forms of IL-6 R are generated by both alternate splicing and proteolytic cleavage. In a mechanism known as trans-signalling, complexes of soluble IL-6 and IL-6 R elicit responses from gp130-expressing cells that lack cell surface IL-6 R. Trans-signalling enables a wider range of cell types to respond to IL-6, as the expression of gp130 is ubiquitous, while that of IL-6 R is predominantly restricted to hepatocytes, leukocytes, and lymphocytes.
Sequence:
HHHHHHHHHHVPPGEDSKDVAAPHRQPLTSSERID KQIRYILDGISALRKETCNKSNMCESSKEALAENN LNLPKMAEKDGCFQSGFNEETCLVKIITGLLEFEV YLEYLQNRFESSEEQARAVQMSTKVLIQFLQKKAK NLDAITTPDPTTNASLLTKLQAQNQWLQDMTTHLI LRSFKEFLQSSLRALRQM
Formulation:
Recombinant human IL-6 is lyophilized from 10mM Phosphate Potasium buffer pH 7.4 and 50mM NaCl.
Purity
Purity >97% by SDS-PAGE gel
Applications:
Functional studies, Cell culture, Western Blot.
Bioassay 1 - Result assay 1:
The specific activity is determined by the dose-dependent stimulation of the proliferation of human TF-1 cells (human erytroleukemic indicator cell line). - ED50 < 1 ng/ml
Bioassay 2 - Result assay 2:
-
Bioassay 3 - Result assay 3:
-
Bioassay 4 - Result assay 4:
-
References:
- Fonseca, J.E. et al. (2009) Interleikin-6 as a key player in systemic inflammation and joint destruction. Autoimmun. Rev., 8:538-542. - Kamimura, D. et al. (2003) Il-6 signal transduction and its physiological roles: signal orchestration model. Rev. Physiol. Biochem. Pharmacol., 149: 1-38. - Kanazawa, T. et al. (2007) Interleukin-6 directly influences proliferation and invasion potential of head and neck cancer cells. Eur. Arch. Otorhinolaryngol., 264:815-821. - Kishimoto, T. (1989) Te biology of interleukin-6. Blood, 74:1-10. - Febbraio, M. A. and B. K. Pedersen (2002) Muscule-derived interleukin-6: mechanisms for activation and possible biological roles. FASEB J., 16: 1335. - Van Sninck, J (1990) Interleukin-6: an overview. Annu. Rev. Immunol., 8:253-78. - Hong, D. et al. (2007) Interleukin-6 and its receptor in cancer: implications for translational therapeutics. Cancer. Nov 1, 110(9):1911-28.
RESCONSTITUTION RECOMENDATION QC SHEET
Centrifuge vial before opening. Lyophilized protein should be reconstituted in water to a concentration of 50 ng/ul. Optimal concentration should be determined for specific application and cell lines.
Storage and Stability:
This lyophilized preparation is stable at 2-8C C for short term, long storage it should be kept at -20C. Reconstituted protein should be stored in working aliquots at –20C. Repeated freezing and thawing is not recommended.
Shipping
Room temperature
Available sizes (ug) :
1 ug, 5 ug, 10 ug, 20 ug, 50 ug of active protein

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Menge: 10ug
Lieferbar: In stock
lieferbar

Vergleichen

Auf den Wunschzettel

Angebot anfordern

Lieferzeit anfragen

Technische Frage stellen

Bulk-Anfrage stellen

Fragen zum Produkt?
 
Schließen