« Zurück
Startseite /
Easy blot Mini SKit IL-6

Easy blot Mini SKit IL-6

ArtNr	RF0090
Hersteller	Agrenvec
Menge	1
Kategorie	Oncology Metabolism Diabetes Glucose Homeostasis By Cell Type Carcinoma Hematology Leukemia Cell Biology Obesity Cell Culture Cytokines Cell Status Necrosis Other Assays & Kits Detection Kits
Typ	Detection Kits
Specific against	other
ECLASS 10.1	32161090
ECLASS 11.0	32161090
UNSPSC	41116126
Lieferbar
Description	Serologic qualitative detection of rh IL-6 using Anti-Human IL-6 Serum is developed in rabbit using recombinant IL-6 produced in plants.
Packaging	Anti-Human IL-6 (Serum). Polyclonal 100 ul lyophilized (RF0044)
	Recombinant Human IL-6 1 ug lyophilized. Positive Control (RF0032)
Immunogen Name	Highly pure (>97%) recombinant human IL-6 expressed in plants.
Immunogen Sequence	VPPGEDSKDVAAPHRQPLTSSERIDKQIRYILDGI SALRKETCNKSNMCESSKEALAENNLNLPKMAEKD GCFQSGFNEETCLVKIITGLLEFEVYLEYLQNRFE SSEEQARAVQMSTKVLIQFLQKKAKNLDAITTPDP TTNASLLTKLQAQNQWLQDMTTHLILRSFKEFLQS SLRALRQM
Formulation	Lyophilized
Positive Control	Recombinant Human IL-6 Active REF 0032. Lyophilized protein should be reconstituted in water to a concentration of 50 ng/ul. Use 100-200 ng by assay Due to the protein nature dimmers and multimers may be observed.
Stabilizers & Preservatives:	Contains 0.01% Sodium Azide.
WB	Suggested starting dilution 1/2, 000. Anti-rabbit IgG-AP (alkaline phosphatase conjugate) is recommended as secondary reagent.
ELISA	Suggested starting dilution 1/2, 000. This antibody, in conjunction with compatible secondary reagents (anti-rabbit IgG-AP conjugate), allows the detection of < of 10 ng/well of rhuman IL-6 (RF0032).
NEUTRALIZATION	No data available.

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

Produkt-Datenblatt anfordern

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 1

lieferbar

Lieferung vsl. bis 18.12.2025

Express-Lieferung: 31 Tage sparen

Vergleichen

Auf den Wunschzettel

Angebot anfordern