Vergleich

Active Recombinant Human Interleukin-4 Europäischer Partner

ArtNr RF0099-250
Hersteller Agrenvec
Menge 250ug
Kategorie
Typ Proteins Recombinant
Specific against other
ECLASS 10.1 32160409
ECLASS 11.0 32160409
UNSPSC 12352202
Alias B-cell stimulatory factor 1
Lieferbar
Molecular Weight:
Recombinant human Interleukin-4 is a polypeptide chain containing 137 amino acids (25 – 153 of P05112 IL4_HUMAN) and 8 aa Histidine-based tag. It has a predicted molecular mass of 16kDa, however as result of potential glycosylation, the recombinant protein could migrate with an apparent molecular mass of 16-18 kDa in SDS-PAGE gel.
Molecular Formula:
C701H1118N216O204S7
p.I:
9, 26
Ext. Coeff. Abs (280nm) 0.1% (=1g/l) =
0, 551
UniProtKB:
P05112
Endotoxin level:
Endotoxin Level : < 0.04 EU / ug protein (LAL method)
Source:
Human recombinant protein expressed in Nicotiana benthamiana. It is produced by transient expression in non-transgenic plants. This product contains no animal–derived components or impurities. Animal Free product.
Description:
Interleukin-4 (IL-4) is a pleiotropic cytokine that regulates diverse T and B cell responses including differentiation of naive T cells into the TH2 phenotype, promoting B cell proliferation, antibody isotype switching, and expression of other TH2 cytokines including IL-5 and IL-9. IL-4 plays a critical role in the development of allergic inflammation and asthma.It enhances both secretion and cell surface expression of IgE and IgG1. It also regulates the expression of the low affinity Fc receptor for IgE (CD23) on both lymphocytes and monocytes. IL-4 is produced primarily by activated CD4+ T-lymphocytes, NK 1.1+ T-cells (NKT), mast cells and basophils. One major role of IL-4 is priming the differentiation of precursor CD4+ T-cells into Th2 effector cells by altering their cytokine expression during activation. IL-4 has also been shown to have other stimulatory effects on B-cells including increased expression of CD23, IL-4R, IgM and MHC class II molecules on their surface.
Sequence:
HHHHHHHHHKCDITLQEIIKTLNSLTEQKTLCTEL TVTDIFAASKNTTEKETFCRAATVLRQFYSHHEKD TRCLGATAQQFHRHKQLIRFLKRLDRNLWGLAGLN SCPVKEANQSTLENFLERLKTIMREKYSKCSS
Formulation:
Recombinant human IL-4 is lyophilized from 10mM Phosphate Potasium buffer pH 7.5 and 100 mM NaCl.
Purity
Purity >97% by SDS-PAGE gel
Applications:
Functional studies, Cell assay, SDS-PAGE, Western Blot, Antibody Production
Bioassay 1 - Result assay 1:
1.The specific activity is determined by the dose-dependent stimulation of the proliferation of human TF-1 cells (human erytroleukemic indicator cell line). - ED50 < 1 ng/ml
Bioassay 2 - Result assay 2:
2. Effect of rH Interleukin-4 on kerotinocytes cell proliferation (HaCaT cells).The activity is determined by the dose-dependent stimulation of the proliferation of kerotinocytes cells and the cell viability was assessed by MTT. - ED50 < 1 ng/ml
Bioassay 3 - Result assay 3:
-
Bioassay 4 - Result assay 4:
-
References:
- Kitamura, T. et al., 1989. Establishment and characterization of a unique human cell line that proliferates dependently on GMCSF, IL-3 or erythropoietin. J. Cell Phyisiol., 140 (3 ): 323-334. - Paul, W.E., 1991.Interleukin-4: a prototypic immunoregulatory lymphokine. Blood, 77, 1859-1870. - Callard, R.E. et al., 1996. IL-4 and IL-13 receptors: are they one and the same? Immunol. Today, 17, 108-110. - O’ Garra, A., and Arai, N., 2000.The molecular basis of T helper 1 and T helper 2 cell differentiation. Trends Cell Biol., 10, 542-550. - Ryan, J.J. et al. 2007. Mast cell homeostasis: a fundamental aspect of allergic disease. Crit. Rev. Immunol., 27, 15-32.
RESCONSTITUTION RECOMENDATION QC SHEET
Centrifuge vial before opening. Lyophilized protein should be reconstituted in water to a concentration of 100 ng/ul. When reconstituting the product, gently pipet and wash down the sides of the vial to ensure full recovery of the protein into solution. Optimal concentration should be determined for specific application and cell lines.
Storage and Stability:
This lyophilized preparation is stable at 2-8C C for short term, long storage it should be kept at -20C. Reconstituted protein should be stored in working aliquots at –20C. Repeated freezing and thawing is not recommended.
Shipping
Room temperature
Available sizes (ug) :
1 ug, 10 ug, 50 ug, 100 ug, 250 ug of active protein

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Menge: 250ug
Lieferbar: In stock
lieferbar

Vergleichen

Auf den Wunschzettel

Angebot anfordern

Lieferzeit anfragen

Technische Frage stellen

Bulk-Anfrage stellen

Fragen zum Produkt?
 
Schließen