Vergleich

Active Recombinant Human Interleukin-10 Europäischer Partner

ArtNr RF0103-250
Hersteller Agrenvec
Menge 250ug
Kategorie
Typ Proteins Recombinant
Specific against other
ECLASS 10.1 32160409
ECLASS 11.0 32160409
UNSPSC 12352202
Alias Cytokine synthesis inhibitory factor/ CSIF.
Lieferbar
Molecular Weight:
Recombinant human IL-10 is a glycosylated, non-disulphide linked homodimer with an apparent molecular mass of 17 kDa due to glycosylation. Glycosylation contributes to stability in cell growth media and other applications.
Molecular Formula:
C871H1358N252O252S11
p.I:
7, 89
Ext. Coeff. Abs (280nm) 0.1% (=1g/l) =
0.390
UniProtKB:
P22301
Endotoxin level:
Endotoxin Level : < 0.04 EU / ug protein (LAL method)
Source:
Human recombinant protein expressed in Nicotiana benthamiana. It is produced by transient expression in non-transgenic plants. This product contains no animal–derived components or impurities. Animal Free product.
Description:
Interleukin 10 (IL-10) is an anti-inflammatory cytokine initially characterized as a T helper (TH)2 specific cytokine, however, further investigations revealed that IL- 10 production was also associated with T regulatory cell responses. It is now known that almost all cells of both the innate and adaptive arms of the immune system can express IL-10, including dendritic cells (DC), macrophages, mast cells, natural killer cells (NK), eosinophil's, neutrophils, B cells, CD8C T cells, and TH1, TH2, and TH17 CD4C T cells IL-10 functions by inhibiting pro-inflammatory cytokines made by macrophages and regulatory T cells including, IFN-gamma, TNF-alpha, IL-2, and IL-3, IL-4, and GM-CSF. IL-10 is also known to suppress antigen presentation on antigen presenting cells. It also stimulates the growth of mast cells, is a cytotoxic T cell differentiation factor, and stimulates B cell differentiation.
Sequence:
HHHHHHHHSPGQGTQSENSCTHFPGNLPNMLRDLR DAFSRVKTFFQMKDQLDNLLLKESLLEDFKGYLGC QALSEMIQFYLEEVMPQAENQDPDIKAHVNSLGEN LKTLRLRLRRCHRFLPCENKSKAVEQVKNAFNKLQ EKGIYKAMSEFDIFINYIEAYMTMKIRN
Formulation:
Recombinant human IL-10 is lyophilized from a Tris HCl 0.05M buffer at pH 7.4.
Purity
Purity >97% by SDS-PAGE gel
Applications:
Functional studies, Cell culture, Western Blot
Bioassay 1 - Result assay 1:
1. Effect of recombinant Human Interleukin-10 on LPS-induced kerotinocytes (HaCaT cells).The activity is determined by changes on the gene expression of proinflammatory cytokines IL-6 and TNF-alpha by qPCR method. - mRNA levels of IL-6 and TNF-alpha cytokines decrease between 1-1.5 fold compared with negative control (not rHuman IL-10 treated cells).
Bioassay 2 - Result assay 2:
-
Bioassay 3 - Result assay 3:
-
Bioassay 4 - Result assay 4:
-
References:
- O’ Garra, A. and P. Vieir, 2004. Regulatory T cells and mechanisms of immune system control. Nat.Med., 10, 801–805. - Maloy, K. J. and F. Powrie, 2001. Regulatory T cells in the control of immune pathology. Nat. Immunol., 2, 816–822. - Fillatreau, S., et al, 2002. B cells regulate autoimmunity by provision of IL- 10. Nat. Immunol., 3, 944–950. - Maynard, C.L. and C.T. Weaver, 2008. Diversity in the contribution of interleukin-10 to T-cell-mediated immune regulation. Immunol.Rev. 226, 219–233. - Mauri, C. and A. Bosma, 2012. Immune regulatory function of B cells. Annu. Rev. Immunol., 30, 221–241.
RESCONSTITUTION RECOMENDATION QC SHEET
Centrifuge vial before opening. Lyophilized protein should be reconstituted in water to a concentration of 100 ng/ul. Due to the protein nature, dimmers and multimers may be observed. Optimal concentration should be determined for specific application and cell lines.
Storage and Stability:
This lyophilized preparation is stable at 2-8C C for short term, long storage it should be kept at -20C. Reconstituted protein should be stored in working aliquots at –20C. Repeated freezing and thawing is not recommended.
Shipping
Room temperature
Available sizes (ug) :
1 ug, 10 ug, 100 ug, 250 ug of active protein

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Menge: 250ug
Lieferbar: In stock
lieferbar

Vergleichen

Auf den Wunschzettel

Angebot anfordern

Lieferzeit anfragen

Technische Frage stellen

Bulk-Anfrage stellen

Fragen zum Produkt?
 
Schließen