Galanin, human

ArtNr	AS-22431
Hersteller	AnaSpec
CAS-Nr.	119418-04-1
Menge	1 mg
Kategorie	Peptides & Proteins Peptides
Typ	Peptides
Format	Lyophilized
Specific against	other
Konjugat/Tag	Unconjugated
Purity	Peak Area by HPLC ≥95%
Sequence	H-Gly-Trp-Thr-Leu-Asn-Ser-Ala-Gly-Tyr-Leu-Leu-Gly-Pro-His-Ala-Val-Gly-Asn-His-Arg-Ser-Phe-Ser-Asp-Lys-Asn-Gly-Leu-Thr-Ser-OH
Citations	Ref: Wang, S. et al. J. Biol. Chem. 272, 31949 (1997).
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	GWTLNSAGYLLGPHAVGNHRSFSDKNGLTS
Versandbedingung	Raumtemperatur
Lieferbar
Manufacturer - Category	Catalog Peptides / Catalog Peptides Gr / Peptides
Manufacturer - Targets	Galanin
Shipping Temperature	RT
Storage Conditions	- 20 °C
Molecular Weight	3157.7
Manufacturer - Research Area	Neuroscience; Cell Signaling / Neuropeptides; GPCR
Description	Galanin, a 29 or 30 (in human) amino acid neuropeptide, is found in the central and peripheral nervous systems and displays several important physiological activities. These actions are mediated through distinct G protein-coupled receptors. It has been involved in food behavior, regulation of sleep and mood, control of blood pression and nociception, among others.
Sequence One-Letter Code	GWTLNSAGYLLGPHAVGNHRSFSDKNGLTS
Post Synthesis Coupling	No
Usage	Research use
UNSPSC	12352202
GTIN	5400535046873

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

Produkt-Datenblatt anfordern

AS-22431-safety-datasheet.pdf