« Zurück
Startseite /
PACAP (1-27), amide, human, ovine, rat - 0.5 mg

PACAP (1-27), amide, human, ovine, rat - 0.5 mg

ArtNr	AS-22527
Hersteller	AnaSpec
Menge	0.5 mg
Kategorie	Peptides & Proteins Peptides
Typ	Peptides
Format	Lyophilized
Specific against	other
Konjugat/Tag	Unconjugated
Purity	Peak Area by HPLC ≥95%
Sequence	H-His-Ser-Asp-Gly-Ile-Phe-Thr-Asp-Ser-Tyr-Ser-Arg-Tyr-Arg-Lys-Gln-Met-Ala-Val-Lys-Lys-Tyr-Leu-Ala-Ala-Val-Leu-NH2
Citations	Ref: Miyata, A. et al. BBRC 164, 567(1998); Chik, C. et al. J. Neurochem. 67, 1005 (1996).
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	HSDGIFTDSYSRYRKQMAVKKYLAAVL-NH2
Versandbedingung	Raumtemperatur
Lieferbar
Manufacturer - Type	Catalog
Manufacturer - Category	Peptides
Manufacturer - Targets	Pituitary adenylate cyclase-activating polypeptide (PACAP)
Shipping Temperature	RT
Storage Conditions	- 20 °C
Molecular Weight	3147.8
Description	PACAP-27, the N-terminal fragment of PACAP-38, is a neuropeptide originally isolated from bovine hypothalamus, but is also found in humans and rats. It shows considerable homology with Vasoactive Intestinal Polypeptide (VIP), but stimulates adenylate cyclase much more potently than VIP. PACAP27 and PACAP38 stimulate cAMP accumulation and increase [Ca2+]i through the type I PACAP receptors.
Product Group	LB1A1Z
Research Area	Hormones; Cell Signaling / Lyophilized
Sequence One-Letter Code	HSDGIFTDSYSRYRKQMAVKKYLAAVL-NH2
GTIN	5400535046521
Usage	Research use
UNSPSC	12352202

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

Produkt-Datenblatt anfordern

AS-22527-safety-datasheet.pdf