« Zurück
Startseite /
Growth Hormone Releasing Factor, GRF (1-29), amide, human - 0.5 mg

Growth Hormone Releasing Factor, GRF (1-29), amide, human - 0.5 mg

ArtNr	AS-22874
Hersteller	AnaSpec
Menge	0.5 mg
Kategorie	Neuroscience Metabolism Diabetes Molecular Targets for Neuroscience Peptides & Proteins Peptides
Typ	Peptides
Format	Lyophilized
Specific against	other
Purity	Peak Area by HPLC ≥95%
Sequence	H-Tyr-Ala-Asp-Ala-Ile-Phe-Thr-Asn-Ser-Tyr-Arg-Lys-Val-Leu-Gly-Gln-Leu-Ser-Ala-Arg-Lys-Leu-Leu-Gln-Asp-Ile-Met-Ser-Arg-NH2
Citations	Ling, N. et al. Proc Natl Acad Sci USA 81, 4302 (1984)Gaudreau, P. et al. J Med Chem 35, 1864 (1992), doi: 10.1021/jm00088a023 Lance, VA. et al. Biochem Biophys Res Commun 119, 265 (1984), doi: 10.1016/0006-291X(84)91647-4 Lapierre, H. et al. Domest Anim Endocrinol 4, 207 (1987) Mayo, KE. et al. Nature 306, 86 (1983)Rivier, J. et al. Nature 300, 276 (1982), doi:10.1038/300276a0Grossman, A. et al. Clin Endocrinol (Oxf) 21, 321 (1984)
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	YADAIFTNSYRKVLGQLSARKLLQDIMSR-NH2
Versandbedingung	Raumtemperatur
Lieferbar
Manufacturer - Type	Catalog
Manufacturer - Category	Peptides
Manufacturer - Targets	Growth Hormone Releasing Factor (GRF, GHRH)
Shipping Temperature	RT
Storage Conditions	- 20 °C
Molecular Weight	3358.1
Description	This hypophysiotropic peptide was isolated from human hypothalamic-hypophysial tissues. Within this 1 to 29 amino acid GRF fragment, amino acids 13 to 21 are more important than 24 to 29 for high affinity receptor binding. Structure-activity studies show that hpGRF(1-29)-NH2 has full intrinsic activity and potency in vitro as the full length GRF in stimulating growth hormone release. Human GRF (1-29) has a high degree (<93%) homology with procine, bovine and ovine GRF (1-29)-NH2.
Product Group	LB1A1Z
Research Area	Hormones / Lyophilized
Sequence One-Letter Code	YADAIFTNSYRKVLGQLSARKLLQDIMSR-NH2
GTIN	5400535045968
Usage	Research use
UNSPSC	12352202

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

Produkt-Datenblatt anfordern

AS-22874-safety-datasheet.pdf