Vergleich

Glucagon-Like Peptide 1, GLP-1 (7-36)-Lys(Biotin), amide, human, mouse, rat, bovine, guinea pig

ArtNr AS-23643
Hersteller AnaSpec
CAS-Nr. 1802086-70-9
Menge 1 mg
Kategorie
Typ Peptides
Format Lyophilized
Specific against other
Konjugat/Tag Biotin
Purity Peak Area by HPLC ≥95%
Sequence H-His-Ala-Glu-Gly-Thr-Phe-Thr-Ser-Asp-Val-Ser-Ser-Tyr-Leu-Glu-Gly-Gln-Ala-Ala-Lys-Glu-Phe-Ile-Ala-Trp-Leu-Val-Lys-Gly-Arg-Lys(Biotin)-NH2
Citations Drucker, D. et al. Proc Natl Acad Sci USA 84, 3434 (1987) Kieffer, T. and J. Habener, Endo Rev 20, 876 (1999) Deacon, CF. et. al. Hormone Metabolic Res 36,761 (2004), doi: 10.1055/s-2004-826160Williams, JA. Pancreadepedia (2014), doi: 10.3998/panc.2014.7Elahi, D. et. al. Obesity (Silver Spring) 16, 1501 (2008), doi: 10.1038/oby.2008.229Ban, K. et. al. Endocrinol 151, 1520 (2010), doi: http://dx.doi.org/10.1210/en.2009-1197
ECLASS 10.1 32160409
ECLASS 11.0 32160409
UNSPSC 12352202
Alias HAEGTFTSDVSSYLEGQAAKEFIAWLVKGRK(Biotin)-NH2
Versandbedingung Raumtemperatur
Lieferbar
Manufacturer - Category
Catalog Peptides / Catalog Peptides Gr / Peptides
Manufacturer - Targets
Glucagon-Like Peptide 1 (GLP-1)
Shipping Temperature
RT
Storage Conditions
- 20 °C
Molecular Weight
3652.3
Manufacturer - Research Area
Diabetes/Metabolism; Hormones; Cell Signaling / Incretins & related Hormones; Gastrointestinal Tract; GPCR
Description
This GLP-1 (7-36) amide contains an additional Lysine (K) residue at its N-terminus, with Biotin coupled to the Lysine side chain. GLP-1 (7-36) amide is an incretin hormone that causes glucose dependent release of insulin by pancreatic beta cells. It is the cleavage product of GLP-1 (1-36) amide peptide. Both GLP-1 (7-36) and GLP-1 (7-37) also play roles in gastric motility (gastric emptying), on the suppression of plasma glucagon levels (glucose production) and possibly on the promotion of satiety and stimulation of glucose disposal in peripheral tissues independent of the actions of insulin. GLP-1 (7-36) has a short half life of less than 2 minutes, and like GIP, is rapidly degraded by the enzyme dipeptidyl peptidase IV (DPP-4), which is widely expressed in a number of sites, including the endothelial cells of small gut arterioles. DPP-4 degrades GLP-1 (7-36) into the non insulinotropic GLP-1 (9-36) (some studies suggest it may have weak insulinotropic activity). As a result, the majority of GLP-1 (and GIP) is inactivated as an insulinotrope before reaching the systemic circulation.
Sequence One-Letter Code
HAEGTFTSDVSSYLEGQAAKEFIAWLVKGRK(Biotin)-NH2
Post Synthesis Coupling
No
Usage
Research use
UNSPSC
12352202
GTIN
5400535042219

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Menge: 1 mg
Lieferbar: In stock
lieferbar

Vergleichen

Auf den Wunschzettel

Angebot anfordern

Lieferzeit anfragen

Technische Frage stellen

Bulk-Anfrage stellen

Fragen zum Produkt?
 
Schließen