Cecropin B

ArtNr	AS-24011
Hersteller	AnaSpec
CAS-Nr.	80451-05-4
Menge	0.5 mg
Kategorie	Peptides & Proteins Peptides
Typ	Peptides
Format	Lyophilized
Specific against	other
Konjugat/Tag	Unconjugated
Purity	Peak Area by HPLC ≥95%
Sequence	H-Lys-Trp-Lys-Val-Phe-Lys-Lys-Ile-Glu-Lys-Met-Gly-Arg-Asn-Ile-Arg-Asn-Gly-Ile-Val-Lys-Ala-Gly-Pro-Ala-Ile-Ala-Val-Leu-Gly-Glu-Ala-Lys-Ala-Leu-NH2
Citations	Ref: Vaara, M. et al. Antimicrob. Agents Chemo. 38, 2498 (1994); Florack, D. et al. Transgenic Res. 4, 132 (1995); Lee, P. et al. Wound Repair Regen. 12, 351 (2004).
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	KWKVFKKIEKMGRNIRNGIVKAGPAIAVLGEAKAL-NH2
Versandbedingung	Raumtemperatur
Lieferbar
Manufacturer - Category	Catalog Peptides / Catalog Peptides Gr / Peptides
Manufacturer - Targets	Cecropin
Shipping Temperature	RT
Storage Conditions	- 20 °C
Molecular Weight	3835
Manufacturer - Research Area	Immunology and Infectious disease / Microbiology/Bacteriology
Description	Cecropin B is a small antibacterial peptide from the giant silkmoth, Hyalophora cecropia. Antimicrobial peptides are essential to innate host defense as effectors of pathogen clearance and can affect host cell to promote wound repair.
Sequence One-Letter Code	KWKVFKKIEKMGRNIRNGIVKAGPAIAVLGEAKAL-NH2
Post Synthesis Coupling	No
Usage	Research use
UNSPSC	12352202
GTIN	5400535041052

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

Produkt-Datenblatt anfordern

AS-24011-safety-datasheet.pdf