« Zurück
Startseite /
B-type Natriuretic Peptide, BNP-32, human - 1 mg

B-type Natriuretic Peptide, BNP-32, human - 1 mg

ArtNr	AS-24016
Hersteller	AnaSpec
Menge	1 mg
Kategorie	Peptides & Proteins Peptides
Typ	Peptides
Format	Lyophilized
Specific against	other
Konjugat/Tag	Unconjugated
Purity	Peak Area by HPLC ≥95%
Sequence	H-Ser-Pro-Lys-Met-Val-Gln-Gly-Ser-Gly-Cys-Phe-Gly-Arg-Lys-Met-Asp-Arg-Ile-Ser-Ser-Ser-Ser-Gly-Leu-Gly-Cys-Lys-Val-Leu-Arg-Arg-His-OH (Disulfide bridge: 10-26)
Citations	Ref: Cardarelli, R. et al. J. Am. Board Fam. Prac. 16, 327 (2003); Sudoh, T. et al. Nature 332, 78 (1988); Cheung, B. et al. JAMA 280, 1983 (1998); Struthers, A. BMJ 308, 1615 (1994); De Lemos, JA. et al. Lancet 362, 316 (2005); Kambayashi, Y. et al. Biochem. Biophys. Res. Commun. 159, 1427 (1989).
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	SPKMVQGSGCFGRKMDRISSSSGLGCKVLRRH (Disulfide bridge: 10-26)
Versandbedingung	Raumtemperatur
Lieferbar
Manufacturer - Type	Catalog
Manufacturer - Category	Peptides
Manufacturer - Targets	Natriuretic Peptide
Shipping Temperature	RT
Storage Conditions	- 20 °C
Molecular Weight	3464.2
Description	This 32 amino acid peptide contains a 17 amino acid ring structure that is common to all natriuretic peptides. It is also called the brain natriuretic peptide (BNP) because it was first identified in porcine brain; however, the main source of this peptide is not the brain but the cardiac ventricle. This cardiac neurohormone is secreted from the ventricles in response to volume expansion and pressure overload. It has natriuretic and vasodilatory effects and suppresses the renin-angiotensin-aldosterone system.
Product Group	LB1A3Z
Research Area	Cardiovascular Research / Lyophilized
Sequence One-Letter Code	SPKMVQGSGCFGRKMDRISSSSGLGCKVLRRH (Disulfide bridge: 10-26)
GTIN	5400535041021
Usage	Research use
UNSPSC	12352202

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

Produkt-Datenblatt anfordern

AS-24016-safety-datasheet.pdf