« Zurück
Startseite /
Gastrin Releasing Peptide, human - 1 mg

Gastrin Releasing Peptide, human - 1 mg

ArtNr	AS-24214
Hersteller	AnaSpec
Menge	1 mg
Kategorie	Oncology Peptides & Proteins Peptides By Organ Lung Cancer
Typ	Peptides
Format	Lyophilized
Specific against	other
Konjugat/Tag	Unconjugated
Purity	Peak Area by HPLC ≥95%
Sequence	H-Val-Pro-Leu-Pro-Ala-Gly-Gly-Gly-Thr-Val-Leu-Thr-Lys-Met-Tyr-Pro-Arg-Gly-Asn-His-Trp-Ala-Val-Gly-His-Leu-Met-NH2
Citations	Kamata, K. et al. Nephrol Dialysis Transplant 11, 1267 (1996), doi: 10.1093/ndt/11.7.1267Tache, Y. et al. Gastroenterol 81, 298 (1981) Siegfried, J. et al. J Biol Chem 269, 8596 (1994)Patel, O. et al. Biochem Pharmacol 68, 2129 (2004), doi: 10.1016/j.bcp.2004.08.009Niederle, B. Wien Klin Wochenschr 119, 561 (2007), doi: 10.1007/s00508-007-0897-x.
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	VPLPAGGGTVLTKMYPRGNHWAVGHLM-NH2
Versandbedingung	Raumtemperatur
Lieferbar
Manufacturer - Type	Catalog
Manufacturer - Category	Peptides
Manufacturer - Targets	Gastrin Releasing Peptide
Shipping Temperature	RT
Storage Conditions	- 20 °C
Molecular Weight	2859.6
Description	Gastrin-releasing peptide, a 27-amino acid peptide isolated from the gut, stimulates the release of Gastrin, and shares a common C-terminal decapeptide homology with bombesin. Gastrin-releasing peptide is an important growth-modulating factor in developing lung epithelium. It is used as a tumor marker in the diagnosis of small-cell lung carcinoma, since it is known to be produced by these cancer cells.
Product Group	LB1A1Z
Research Area	Hormones; Cell Signaling; Cancer & Apoptosis / Lyophilized
Sequence One-Letter Code	VPLPAGGGTVLTKMYPRGNHWAVGHLM-NH2
GTIN	5400535040635
Usage	Research use
UNSPSC	12352202

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

Produkt-Datenblatt anfordern

AS-24214-safety-datasheet.pdf