« Zurück
Startseite /
Glucagon (1-29), bovine, human, rat, porcine, FAM-labeled - 1 mg

Glucagon (1-29), bovine, human, rat, porcine, FAM-labeled - 1 mg

ArtNr	AS-60273-1
Hersteller	AnaSpec
Menge	1 mg
Kategorie	Metabolism Diabetes Glucose Homeostasis Peptides & Proteins Peptides
Typ	Peptides
Format	Lyophilized
Specific against	other
Konjugat/Tag	Unconjugated
Purity	Peak Area by HPLC ≥95%
Sequence	FAM-His-Ser-Gln-Gly-Thr-Phe-Thr-Ser-Asp-Tyr-Ser-Lys-Tyr-Leu-Asp-Ser-Arg-Arg-Ala-Gln-Asp-Phe-Val-Gln-Trp-Leu-Met-Asn-Thr-OH
Citations	O'Harte. FP. et. al. Mol Cell Endocrinol 381, 26 (2013), doi: 10.1016/j.mce.2013.07.014Drucker DJ. Endocrinology: Adult and Pediatric (7th Ed.) 1, 586 (2016), doi:10.1016/B978-0-323-18907-1.00034-2
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	FAM-HSQGTFTSDYSKYLDSRRAQDFVQWLMNT
Versandbedingung	Raumtemperatur
Lieferbar
Manufacturer - Type	Catalog
Manufacturer - Category	Peptides
Manufacturer - Targets	Glucagon
Manufacturer - Conjugate / Tag	FAM
Shipping Temperature	RT
Storage Conditions	- 20 °C Protected from light
Molecular Weight	3841.3
Description	This is a fluorescent (FAM)-labeled Glucagon peptide, Abs/Em=494/521 nm. Glucagon is a peptide hormone secreted from the pancreatic Islet of Langerhans alpha-cells, in response to low circulating blood glucose levels in order to restore normal glucose levels. It acts on hepatic enzymes that regulate glucose production and glycogen synthesis. Excessive amounts of circulating glucagon levels is implicated in the metabolic dysregulation of type 2 diabetes, since such conditions result in hyperglycaemia.
Product Group	LB1A4Z
Research Area	Diabetes/Metabolism; Hormones; Cell Signaling / Lyophilized
Absorbtion (nm)	494
Emission (nm)	521
Sequence One-Letter Code	FAM-HSQGTFTSDYSKYLDSRRAQDFVQWLMNT
GTIN	5400535158767
Detection Method	Fluorescent
Usage	Research use
UNSPSC	12352202

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

Produkt-Datenblatt anfordern

AS-60273-1-safety-datasheet.pdf