« Zurück
Startseite /
Exendin 4, FAM-labeled

Exendin 4, FAM-labeled

ArtNr	AS-60280-05
Hersteller	AnaSpec
Menge	0.5 mg
Kategorie	Peptides & Proteins Peptides
Typ	Peptides
Format	Lyophilized
Specific against	other
Purity	Peak Area by HPLC ≥95%
Sequence	FAM-His-Gly-Glu-Gly-Thr-Phe-Thr-Ser-Asp-Leu-Ser-Lys-Gln-Met-Glu-Glu-Glu-Ala-Val-Arg-Leu-Phe-Ile-Glu-Trp-Leu-Lys-Asn-Gly-Gly-Pro-Ser-Ser-Gly-Ala-Pro-Pro-Pro-Ser-NH2
Citations	Eng, J. et al. J Biol Chem 267, 7402 (1992)Greig, NH. et al. Diabetolog 42, 45 (1999)Göke R. et al. J Biol Chem 268, 19650 (1993)
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	FAM-HGEGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS-NH2
Versandbedingung	Raumtemperatur
Lieferbar
Manufacturer - Category	Catalog Peptides / Catalog Peptides Gr / Peptides
Manufacturer - Targets	Exendin
Manufacturer - Conjugate / Tag	Fluorescent dyes: FAM
Shipping Temperature	RT
Storage Conditions	- 20 °C Protected from light
Molecular Weight	4545.1
Manufacturer - Research Area	Diabetes/Metabolism / Incretins & related Hormones
Description	This full length Exendin 4 amide peptide is labeled with a fluorescent dye (FAM), Abs/Em = 494/519 nm, on its N-terminus. Exendin-4, an agonist of glucagon-like peptide 1 (GLP-1) receptor, induces release of insulin after food intake. Exendin-4 shares a 53% sequence homology with GLP-1. Derived from Gila monster, Heloderma suspectum, Exendin-4 has a longer half life than GLP-1 in the plasma, thus making it a more potent insulinotropic agent.
Absorbtion (nm)	494
Emission (nm)	519
Sequence One-Letter Code	FAM-HGEGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS-NH2
Detection Method	Fluorescent
Post Synthesis Coupling	No
Usage	Research use
UNSPSC	12352202
GTIN	5400535158644

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

Produkt-Datenblatt anfordern

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 0.5 mg

lieferbar

Lieferung vsl. bis 19.02.2026

Express-Lieferung: 3 Tage sparen

Vergleichen

Auf den Wunschzettel

Angebot anfordern