Vergleich

B-type Natriuretic Peptide, BNP-45 (51-95), rat

ArtNr AS-61153
Hersteller AnaSpec
CAS-Nr. 123337-89-3
Menge 0.5 mg
Kategorie
Typ Peptides
Format Lyophilized
Specific against other
Konjugat/Tag Unconjugated
Purity Peak Area by HPLC ≥95%
Sequence H-Ser-Gln-Asp-Ser-Ala-Phe-Arg-Ile-Gln-Glu-Arg-Leu-Arg-Asn-Ser-Lys-Met-Ala-His-Ser-Ser-Ser-Cys-Phe-Gly-Gln-Lys-Ile-Asp-Arg-Ile-Gly-Ala-Val-Ser-Arg-Leu-Gly-Cys-Asp-Gly-Leu-Arg-Leu-Phe-OH (Disulfide bridge:23-39)
Citations Steinhelper, ME. Circ. Res. 72: 984-992. (1993).
ECLASS 10.1 32160409
ECLASS 11.0 32160409
UNSPSC 12352202
Alias SQDSAFRIQERLRNSKMAHSSSCFGQKIDRIGAVSRLGCDGLRLF (Disulfide bridge:23-39)
Versandbedingung Raumtemperatur
Lieferbar
Manufacturer - Category
Catalog Peptides / Catalog Peptides Gr / Peptides
Manufacturer - Targets
Natriuretic Peptide
Shipping Temperature
RT
Storage Conditions
- 20 °C
Molecular Weight
5041
Manufacturer - Research Area
Cardiovascular Research / Vasoconstriction/Vasodilation
Description
BNP-45 represents the 45 amino acids at the C-terminus and the mouse BNP-45 has all the amino acid residues thought essential for NP bioactivity, although sequence identity when studied with other BNP hormones (rat, 64%; dog, 53%; pig, 50%; and human, 44%) was clearly less than the identity among ANF hormones. Further, sequence identity between rat and mouse BNP prohormones is found to be more conserved in the N-terminal portion of the prohormone than in the C-terminal BNP-45 (88% versus 64%). The threonine 81 residue at which a protein kinase C phosphorylation site is present in the putative mature mouse BNP-45 hormone is not conserved in the rat sequence. Comparing the amino acid sequence surrounding the proteolytic processing site for BNP-32 in human, pig, and dog BNP with the corresponding site for BNP-45 in the rat and mouse sequence we find that all of the secreted BNP hormones have an N-terminal serine preceded by an arginine in the prohormone sequence, and the mouse and rat sequences are highly conserved at the putative scissile bond (LKRVLR-SQ). Further comparative sequence analysis indicates that an arginine being present at position -4 relative to the scissile (R-S) bond in all mammalian BNP precursors. Thus, processing of BNP prohormones to both BNP-45 in rodents and BNP-32 in higher mammals appears to require a protease with a conserved recognition sequence (RXXR-S). Also, the conserved sequences in the BNP prohormones matches the consensus cleavage site for human furin, a calcium-dependent serine endoprotease expressed in mouse heart, and possibly having a role in processing BNP precursors.
Sequence One-Letter Code
SQDSAFRIQERLRNSKMAHSSSCFGQKIDRIGAVSRLGCDGLRLF (Disulfide bridge:23-39)
Post Synthesis Coupling
No
Usage
Research use
UNSPSC
12352202
GTIN
5400535154905

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Menge: 0.5 mg
Lieferbar: In stock
lieferbar

Vergleichen

Auf den Wunschzettel

Angebot anfordern

Lieferzeit anfragen

Technische Frage stellen

Bulk-Anfrage stellen

Fragen zum Produkt?
 
Schließen