« Zurück
Startseite /
CAP-18, rabbit - 0.5 mg

CAP-18, rabbit - 0.5 mg

ArtNr	AS-61307
Hersteller	AnaSpec
Menge	0.5 mg
Kategorie	Peptides & Proteins Peptides
Typ	Peptides
Format	Lyophilized
Specific against	other
Konjugat/Tag	Unconjugated
Purity	Peak Area by HPLC ≥95%
Sequence	H-Gly-Leu-Arg-Lys-Arg-Leu-Arg-Lys-Phe-Arg-Asn-Lys-Ile-Lys-Glu-Lys-Leu-Lys-Lys-Ile-Gly-Gln-Lys-Ile-Gln-Gly-Leu-Leu-Pro-Lys-Leu-Ala-Pro-Arg-Thr-Asp-Tyr-OH
Citations	Travis, S et al. Infect. Immun. 68, 2748 (2000).
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	GLRKRLRKFRNKIKEKLKKIGQKIQGLLPKLAPRTDY
Versandbedingung	Raumtemperatur
Lieferbar
Manufacturer - Type	Catalog
Manufacturer - Category	Peptides
Manufacturer - Targets	Cathelicidin
Shipping Temperature	RT
Storage Conditions	- 20 °C
Molecular Weight	4433.7
Description	This 37 residue peptide is a very effective antimicrobial agent in rabbits. The CAP-18 cathelicidin-derived peptide kills bacteria by disrupting the bacterial membrane. It has a potential for the treatment of bacterial infections in normal and immunocompromised persons and individuals with cystic fibrosis. In experiments it demonstrates the greatest activity against over 20 clinical strains of Pseudomonas aeruginosa. Homologs of CAP18 in other species include humans (FALL39/LL37), mice (mCRAMP), rats (rCRAMP), and sheep (SMAP29 and SMAP34).
Product Group	LB1A1Z
Research Area	Immunology and Infectious disease / Lyophilized
Sequence One-Letter Code	GLRKRLRKFRNKIKEKLKKIGQKIQGLLPKLAPRTDY
GTIN	5400535154158
Usage	Research use
UNSPSC	12352202

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

Produkt-Datenblatt anfordern

AS-61307-safety-datasheet.pdf