« Zurück
Startseite /
β-Amyloid (1-42)-Lys(Biotin)-NH2 - 0.5 mg

β-Amyloid (1-42)-Lys(Biotin)-NH2 - 0.5 mg

ArtNr	AS-61484-05
Hersteller	AnaSpec
Menge	0.5 mg
Kategorie	Peptides & Proteins Peptides
Typ	Peptides
Format	Lyophilized
Specific against	other
Konjugat/Tag	Unconjugated
Purity	Peak Area by HPLC ≥95%
Sequence	H-Asp-Ala-Glu-Phe-Arg-His-Asp-Ser-Gly-Tyr-Glu-Val-His-His-Gln-Lys-Leu-Val-Phe-Phe-Ala-Glu-Asp-Val-Gly-Ser-Asn-Lys-Gly-Ala-Ile-Ile-Gly-Leu-Met-Val-Gly-Gly-Val-Val-Ile-Ala-Lys(Biotin)-NH2
Citations	Elbaum, D. et al. Biochem. Biophys. Res. Commun. 267, 733 (2000).
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIA-K(Biotin)-NH2
Versandbedingung	Raumtemperatur
Lieferbar
Manufacturer - Type	Catalog
Manufacturer - Category	Peptides
Manufacturer - Targets	beta-amyloid; beta-amyloid (1-42)
Shipping Temperature	RT
Storage Conditions	- 20 °C
Molecular Weight	4867.9
Description	Beta-Amyloid (1-42), a major component of amyloid plaques, accumulates in neurons of Alzheimer's disease brains. Biochemical analysis of the amyloid peptides isolated from Alzheimer's disease brain indicates that Beta-Amyloid (1-42) is the principal species associated with senile plaque amyloids, while Beta-Amyloid (1-40) is more abundant in cerebrovascular amyloid deposit. This peptide is biotinylated at the C-terminus.
Product Group	LB1A3Z
Research Area	Neuroscience / Lyophilized
Sequence One-Letter Code	DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIA-K(Biotin)-NH2
GTIN	5400535152611
Usage	Research use
UNSPSC	12352202

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

Produkt-Datenblatt anfordern

AS-61484-05-safety-datasheet.pdf