« Zurück
Startseite /
Glucagon-Like Peptide-2, GLP-2 (1-34), human - 1 mg

Glucagon-Like Peptide-2, GLP-2 (1-34), human - 1 mg

ArtNr	AS-62068
Hersteller	AnaSpec
Menge	1 mg
Kategorie	Metabolism Diabetes Glucose Homeostasis Peptides & Proteins Peptides
Typ	Peptides
Format	Lyophilized
Specific against	other
Purity	Peak Area by HPLC ≥95%
Sequence	H-His-Ala-Asp-Gly-Ser-Phe-Ser-Asp-Glu-Met-Asn-Thr-Ile-Leu-Asp-Asn-Leu-Ala-Ala-Arg-Asp-Phe-Ile-Asn-Trp-Leu-Ile-Gln-Thr-Lys-Ile-Thr-Asp-Arg-OH
Citations	Yusta, B. et al. J Biol Chem 274, 30459 (1999)Drucker, D. Gastroenterol 122, 531 (2002).
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	HADGSFSDEMNTILDNLAARDFINWLIQTKITDR
Versandbedingung	Raumtemperatur
Lieferbar
Manufacturer - Type	Catalog
Manufacturer - Category	Peptides
Manufacturer - Targets	Glucagon-Like Peptide 1 (GLP-1)
Shipping Temperature	RT
Storage Conditions	- 20 °C
Molecular Weight	3922.6
Description	Glucagon-like peptide-2 (GLP-2) promotes nutrient absorption via expansion of the mucosal epithelium by stimulation of crypt cell proliferation and inhibition of apoptosis in the small intestine. It also reduces epithelial permeability, and decreases meal-stimulated gastric acid secretion and gastrointestinal motility. GLP-2 promotes the expansion of the intestinal epithelium through stimulation of the GLP-2 receptor, a member of the glucagon-secretin G protein-coupled receptor superfamily.
Product Group	LB1A1Z
Research Area	Diabetes/Metabolism; Hormones; Cell Signaling / Lyophilized
Sequence One-Letter Code	HADGSFSDEMNTILDNLAARDFINWLIQTKITDR
GTIN	5400535149949
Usage	Research use
UNSPSC	12352202

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

Produkt-Datenblatt anfordern

AS-62068-safety-datasheet.pdf