« Zurück
Startseite /
SLC34A3 Antibody - middle region

SLC34A3 Antibody - middle region

ArtNr	ARP32173_P050-25UL
Hersteller	AVIVA Systems Biology
Menge	25 ul
Kategorie	Food Safety Neuroscience Neural Lineage Markers Antibodies Western Blot Primary Antibodies GMO Neurodegeneration Markers
Typ	Antibody Polyclonal
Format	Liquid
Applikationen	WB
Specific against	Human (Homo sapiens), Mouse (Murine, Mus musculus), Rat (Rattus norvegicus), Dog (Canine, Canis lupus familiaris)
Host	Rabbit
Sequence	LLERLSELALGAASLTPRAQAPDILKVLTKPLTHLIVQLDSDMIMSSATG
Citations	Starke, S., Cox, C., SÃƒÂ¼dekum, K.-H. & Huber, K. Species-specific responses of N homeostasis and electrolyte handling to low N intake: a comparative physiological approach in a monogastric and a ruminant species. J. Comp. Physiol. B. 184, 137-47 (2014). 24129944 Yamamoto,T., (2007) J. Bone Miner. Metab. 25 (6), 407-413
ECLASS 10.1	32160702
ECLASS 11.0	32160702
UNSPSC	12352203
Alias	HHRH,NPTIIc
Versandbedingung	Gekühlt
Lieferbar
Manufacturer - Type	Polyclonal Antibody
Manufacturer - Category	Root Catalog/Products/Polyclonal Antibodies, Root Catalog/Products/Polyclonal Antibodies/Membrane Protein, Root Catalog/Products/Polyclonal Antibodies/Trial Size Polyclonal Antibodies, Root Catalog/Products/Polyclonal Antibodies/Enhanced Validation Polyclonal Antibodies, Root Catalog/Products/Primary Antibodies, Root Catalog/Products/Aviva Rabbit Polyclonal
Shipping Temperature	Wet Ice
Molecular Weight	64 kDa
Species Tested	Human
Gene symbol	SLC34A3
Gene Fullname	Solute carrier family 34 (sodium phosphate), member 3
Protein size	599
Product format	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and storage	For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Partner proteins	SNTA1; PDZK1;
Description of target	SLC34A3 contributes to the maintenance of inorganic phosphate (Pi) concentration at the kidney.
Nucleotide accession_num	NM_080877
Protein accession_num	NP_543153
Protein name	Sodium-dependent phosphate transport protein 2C
Clonality	Polyclonal
Purification	Affinity Purified
Immunogen	The immunogen is a synthetic peptide directed towards the middle region of human SLC34A3
Homology	Dog: 85%; Human: 100%; Mouse: 100%; Rat: 100%
Concentration	0.5 mg/ml

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

Produkt-Datenblatt anfordern

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 25 ul

lieferbar

Lieferung vsl. bis 27.11.2025

Express-Lieferung: 1 Tage sparen

Vergleichen

Auf den Wunschzettel

Angebot anfordern