« Zurück
Startseite /
CNP Antibody - N-terminal region

CNP Antibody - N-terminal region

ArtNr	ARP33880_T100-25UL
Hersteller	AVIVA Systems Biology
Menge	25 ul
Kategorie	Oncology Neuroscience Neural Lineage Markers Molecular Targets for Neuroscience Targets for Rodent Neurosciences Antibodies Immunoprecipitation Western Blot Primary Antibodies By Organ Testicular & Prostate Cancer Calcium Binding Protein Markers Microglia Markers
Typ	Antibody Polyclonal
Format	Liquid
Applikationen	WB, IP
Specific against	Human (Homo sapiens), Rat (Rattus norvegicus), Sheep (Ovine, Ovis aries), Dog (Canine, Canis lupus familiaris), Horse (Equine), Pig (Porcine, Sus scrofa domesticus), Cow (Bos taurus)
Host	Rabbit
Sequence	YKITPGARGAFSEEYKRLDEDLAAYCRRRDIRILVLDDTNHERERLEQLF
Citations	Peirce,T.R., et al., (2006) Arch. Gen. Psychiatry 63 (1), 18-24
ECLASS 10.1	32160702
ECLASS 11.0	32160702
UNSPSC	12352203
Alias	CNP1,HLD20
Versandbedingung	Gekühlt
Lieferbar
Manufacturer - Type	Polyclonal Antibody
Manufacturer - Category	Root Catalog/Products/Polyclonal Antibodies, Root Catalog/Research Areas/Chromatin & Nuclear Signaling, Root Catalog/Research Areas/Membrane & Traffic, Root Catalog/Products/Polyclonal Antibodies/Trial Size Polyclonal Antibodies, Root Catalog/Products/Primary Antibodies, Root Catalog/Products/Aviva Rabbit Polyclonal
Shipping Temperature	Wet Ice
Molecular Weight	45kDa
Species Tested	Human, Mouse
Gene symbol	CNP
Gene Fullname	2', 3'-cyclic nucleotide 3' phosphodiesterase
Protein size	401
Product format	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and storage	For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Partner proteins	UBC; FAM96B; CIAO1; SOX2; MMS19; PEX14; MTNR1A; PRNP; PPP1CA; TUBA1A; PRKCD;
Description of target	2', 3'-Cyclic nucleotide-3'-phosphodiesterase (CNP1 and CNP2) is the major enzyme of central nervous system myelin. It is associated with oligodendroglial plasma membrane and uncompacted myelin (myelin-like fraction), which are in contact with glial cytoplasm
Nucleotide accession_num	NM_033133
Protein accession_num	NP_149124
Protein name	2', 3'-cyclic-nucleotide 3'-phosphodiesterase
Clonality	Polyclonal
Purification	Protein A purified
Immunogen	The immunogen is a synthetic peptide directed towards the N terminal region of human CNP
Homology	Cow: 85%; Dog: 92%; Horse: 100%; Human: 100%; Pig: 92%; Rat: 77%; Sheep: 100%
Concentration	1.0 mg/ml
Sample Type Confirmation	CNP is supported by BioGPS gene expression data to be expressed in Jurkat

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

Produkt-Datenblatt anfordern

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 25 ul

lieferbar

Lieferung vsl. bis 26.02.2026

Express-Lieferung: 8 Tage sparen

Vergleichen

Auf den Wunschzettel

Angebot anfordern