« Zurück
Startseite /
ZNF258 Antibody - middle region

ZNF258 Antibody - middle region

ArtNr	ARP34839_P050-25UL
Hersteller	AVIVA Systems Biology
Menge	25 ul
Kategorie	Oncology Antibodies By Cell Type Immunohistochemistry Western Blot Primary Antibodies
Typ	Antibody Polyclonal
Format	Liquid
Applikationen	WB, IHC
Specific against	Human (Homo sapiens), Rabbit (Oryctolagus cuniculus), Dog (Canine, Canis lupus familiaris), Horse (Equine)
Host	Rabbit
Sequence	TPVITSVMSLAKIPATLSTGNTNSVLKGAVTKEAAKIIQDESTQEDAMKF
Citations	Smedley,D., et al., (1999) Genomics 60 (2), 244-247
ECLASS 10.1	32160702
ECLASS 11.0	32160702
UNSPSC	12352203
Alias	MYM,ZBED7,ZNF258,Buster2,ZNF198L4
Versandbedingung	Gekühlt
Lieferbar
Manufacturer - Type	Polyclonal Antibody
Manufacturer - Category	Root Catalog/Products/Polyclonal Antibodies, Root Catalog/Research Areas/DNA\/RNA\/Protein Interactions, Root Catalog/Research Areas/Immunohistochemistry, Root Catalog/Research Areas/Cell Morphogenesis, Root Catalog/Products/Polyclonal Antibodies/Trial Size Polyclonal Antibodies, Root Catalog/Products/Primary Antibodies, Root Catalog/Products/Aviva Rabbit Polyclonal
Shipping Temperature	Wet Ice
Molecular Weight	79kDa
Species Tested	Human
Gene symbol	ZMYM6
Gene Fullname	Zinc finger, MYM-type 6
Protein size	723
Product format	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and storage	For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Partner proteins	SUMO2; KLHL13; CDK9;
Description of target	ZNF258 is part of a novel, putative, zinc-binding motif (MYM) family which encodes proteins that maintain the repeats of the MYM motif.
Nucleotide accession_num	NM_007167
Protein accession_num	NP_009098
Protein name	Zinc finger MYM-type protein 6
Clonality	Polyclonal
Purification	Affinity Purified
Immunogen	The immunogen is a synthetic peptide directed towards the middle region of human ZNF258
Homology	Dog: 91%; Horse: 79%; Human: 100%; Rabbit: 85%
Concentration	0.5 mg/ml
Sample Type Confirmation	There is BioGPS gene expression data showing that ZMYM6 is expressed in Jurkat

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

Produkt-Datenblatt anfordern

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 25 ul

lieferbar

Lieferung vsl. bis 30.10.2025

Express-Lieferung: 3 Tage sparen

Vergleichen

Auf den Wunschzettel

Angebot anfordern