« Zurück
Startseite /
GABRA1 Antibody - N-terminal region

GABRA1 Antibody - N-terminal region

ArtNr	ARP34976_P050-25UL
Hersteller	AVIVA Systems Biology
Menge	25 ul
Kategorie	Oncology Neuroscience Molecular Targets for Neuroscience Neural Signaling Antibodies By Cell Type Immunoprecipitation Western Blot Primary Antibodies
Typ	Antibody Polyclonal
Format	Liquid
Applikationen	WB, IP
Specific against	Human (Homo sapiens), Mouse (Murine, Mus musculus), Rat (Rattus norvegicus), Rabbit (Oryctolagus cuniculus), Dog (Canine, Canis lupus familiaris), Pig (Porcine, Sus scrofa domesticus), Cow (Bos taurus)
Host	Rabbit
Sequence	WAWILLLSTLTGRSYGQPSLQDELKDNTTVFTRILDRLLDGYDNRLRPGL
Citations	Peran,M., et al., (2004) Neurosci. Lett. 364 (2), 67-70
ECLASS 10.1	32160702
ECLASS 11.0	32160702
UNSPSC	12352203
Alias	EJM,ECA4,EJM5,DEE19,EIEE19
Versandbedingung	Gekühlt
Lieferbar
Manufacturer - Type	Polyclonal Antibody
Manufacturer - Category	Root Catalog/Products/Polyclonal Antibodies, Root Catalog/Products/Polyclonal Antibodies/Ion Channel, Root Catalog/Products/Polyclonal Antibodies/Signal Proteins, Root Catalog/Products/Polyclonal Antibodies/Membrane Protein, Root Catalog/Research Areas/Receptors, Root Catalog/Products/Polyclonal Antibodies/Trial Size Polyclonal Antibodies, Root Catalog/Products/Primary Antibodies, Root Catalog/Products/Aviva Rabbit Polyclonal
Shipping Temperature	Wet Ice
Molecular Weight	52kDa
Species Tested	Human
Gene symbol	GABRA1
Gene Fullname	Gamma-aminobutyric acid (GABA) A receptor, alpha 1
Protein size	456
Product format	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and storage	For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Partner proteins	UBQLN1; PRKCG; PRKCD; PPP3CA;
Description of target	GABA is the major inhibitory neurotransmitter in the mammalian brain where it acts at GABA-A receptors, which are ligand-gated chloride channels. Chloride conductance of these channels can be modulated by agents such as benzodiazepines that bind to the GABA-A receptor. At least 16 distinct subunits of GABA-A receptors have been identified.
Subunit	alpha-1
Nucleotide accession_num	NM_000806
Protein accession_num	NP_000797
Protein name	Gamma-aminobutyric acid receptor subunit alpha-1
Clonality	Polyclonal
Purification	Affinity Purified
Immunogen	The immunogen is a synthetic peptide directed towards the N terminal region of human GABRA1
Homology	Cow: 100%; Dog: 93%; Human: 100%; Mouse: 92%; Pig: 86%; Rabbit: 100%; Rat: 92%
Concentration	0.5 mg/ml

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

Produkt-Datenblatt anfordern

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 25 ul

lieferbar

Lieferung vsl. bis 30.10.2025

Express-Lieferung: 3 Tage sparen

Vergleichen

Auf den Wunschzettel

Angebot anfordern