« Zurück
Startseite /
Nkx2-3 Antibody - C-terminal region

Nkx2-3 Antibody - C-terminal region

ArtNr	ARP36944_P050-25UL
Hersteller	AVIVA Systems Biology
Menge	25 ul
Kategorie	Oncology Antibodies Cell Biology Cell Movement Cell Adhesion Immunohistochemistry Western Blot Primary Antibodies By Organ Head & Neck Cancer
Typ	Antibody Polyclonal
Format	Liquid
Applikationen	WB, IHC
Specific against	Human (Homo sapiens), Mouse (Murine, Mus musculus), Rat (Rattus norvegicus), Guinea Pig, Cow (Bos taurus)
Host	Rabbit
Sequence	AAAYSGSYGCAYPTGGGGGGGGTASAATTAMQPACSATGGGSFVNVSNLG
ECLASS 10.1	32160702
ECLASS 11.0	32160702
UNSPSC	12352203
Alias	ti,Nkx2.,Nkx-2.,Nkx2.3,nkx2-C,tinman,Nkx-2.3
Versandbedingung	Gekühlt
Lieferbar
Manufacturer - Type	Polyclonal Antibody
Manufacturer - Category	Root Catalog/Products/Polyclonal Antibodies, Root Catalog/Products/Polyclonal Antibodies/Transcription Factor, Root Catalog/Products/Polyclonal Antibodies/Signal Proteins, Root Catalog/Research Areas/Chromatin & Nuclear Signaling, Root Catalog/Research Areas/Immunology, Root Catalog/Research Areas/Disease Related, Root Catalog/Research Areas/DNA\/RNA\/Protein Interactions, Root Catalog/Research Areas/Immunohistochemistry, Root Catalog/Research Areas/Transcription Factors, Root Catalog/Research Areas/Cell Differentiation, Root Catalog/Products/Polyclonal Antibodies/Trial Size Polyclonal Antibodies, Root Catalog/Products/Polyclonal Antibodies/Enhanced Validation Polyclonal Antibodies, Root Catalog/Products/Primary Antibodies, Root Catalog/Products/Aviva Rabbit Polyclonal
Shipping Temperature	Wet Ice
Molecular Weight	38 kDa
Species Tested	Mouse
Gene symbol	NKX2-3
Gene Fullname	NK2 transcription factor related, locus 3 (Drosophila)
Protein size	362
Product format	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and storage	For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Partner proteins	Zfp263; Cdx1;
Description of target	Nkx2-3 is a transcriptional regulator essential for normal development and functions of the small intestine and spleen.Nkx2-3 activates directly MADCAM1 expression.Nkx2-3 is required for homing of lymphocytes in spleen and mucosa-associated lymphoid tissue. Nkx2-3 may have a role during pharyngeal organogenesis.
Nucleotide accession_num	NM_008699
Protein accession_num	NP_032725
Protein name	Homeobox protein Nkx-2.3
Clonality	Polyclonal
Purification	Affinity Purified
Immunogen	The immunogen is a synthetic peptide directed towards the c terminal region of mouse Nkx2-3
Homology	Cow: 87%; Guinea Pig: 87%; Human: 87%; Mouse: 100%; Rat: 93%
Concentration	0.5 mg/ml

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

Produkt-Datenblatt anfordern

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 25 ul

lieferbar

Lieferung vsl. bis 30.10.2025

Express-Lieferung: 3 Tage sparen

Vergleichen

Auf den Wunschzettel

Angebot anfordern