« Zurück
Startseite /
Msx3 Antibody - C-terminal region

Msx3 Antibody - C-terminal region

ArtNr	ARP37096_P050-25UL
Hersteller	AVIVA Systems Biology
Menge	25 ul
Kategorie	Neuroscience Neural Transcription Factors Antibodies Western Blot Primary Antibodies
Typ	Antibody Polyclonal
Format	Liquid
Applikationen	WB
Specific against	Mouse (Murine, Mus musculus), Rat (Rattus norvegicus)
Host	Rabbit
Sequence	EKLKLTAKPLLPAAFALPFPLGTQLHSSAATFGGNAVPGILAGPVAAYGM
ECLASS 10.1	32160702
ECLASS 11.0	32160702
UNSPSC	12352203
Versandbedingung	Gekühlt
Lieferbar
Manufacturer - Type	Polyclonal Antibody
Manufacturer - Category	Root Catalog/Products/Polyclonal Antibodies, Root Catalog/Products/Polyclonal Antibodies/Transcription Factor, Root Catalog/Research Areas/Chromatin & Nuclear Signaling, Root Catalog/Products/Polyclonal Antibodies/Trial Size Polyclonal Antibodies, Root Catalog/Products/Primary Antibodies, Root Catalog/Products/Aviva Rabbit Polyclonal
Shipping Temperature	Wet Ice
Molecular Weight	22kDa
Species Tested	Rat
Gene symbol	MSX3
Gene Fullname	homeobox, msh-like 3
Protein size	204
Product format	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and storage	For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Description of target	Mouse homolog represses transcription of Msx1; repression may be mediated by binding to cAMP-response element binding protein CBP and histone deacetylase 1.
Nucleotide accession_num	NM_053712
Protein accession_num	NP_446164
Protein name	Protein Msx3 Ensembl ENSRNOP00000067831
Clonality	Polyclonal
Purification	Affinity Purified
Immunogen	The immunogen is a synthetic peptide directed towards the C-terminal region of Rat Msx3
Homology	Mouse: 100%; Rat: 100%
Concentration	0.5 mg/ml

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

Produkt-Datenblatt anfordern

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 25 ul

lieferbar

Lieferung vsl. bis 11.12.2025

Express-Lieferung: 8 Tage sparen

Vergleichen

Auf den Wunschzettel

Angebot anfordern