« Zurück
Startseite /
SREBF1 Antibody - N-terminal region

SREBF1 Antibody - N-terminal region

ArtNr	ARP37145_P050-25UL
Hersteller	AVIVA Systems Biology
Menge	25 ul
Kategorie	Oncology Neuroscience Metabolism Glucose Homeostasis Cholesterol & Lipid Metabolism Targets for Rodent Neurosciences Aging & Neurological Disorders Antibodies By Cell Type Hematology Myeloma Western Blot Primary Antibodies
Typ	Antibody Polyclonal
Format	Liquid
Applikationen	WB
Specific against	Mouse (Murine, Mus musculus), Rat (Rattus norvegicus)
Host	Rabbit
Sequence	DIEDMLQLINNQDSDFPGLFDAPYAGGETGDTGPSSPGANSPESFSSASL
Citations	Briancon,N. (2006) EMBO J. 25 (6), 1253-1262
ECLASS 10.1	32160702
ECLASS 11.0	32160702
UNSPSC	12352203
Alias	SRE,ADD-,ADD1,SREB,SREBP,bHLHd,SREBP1,bHLHd1
Versandbedingung	Gekühlt
Lieferbar
Manufacturer - Type	Polyclonal Antibody
Manufacturer - Category	Root Catalog/Products/Polyclonal Antibodies, Root Catalog/Products/Polyclonal Antibodies/RNA Binding Proteins, Root Catalog/Products/Polyclonal Antibodies/Various, Root Catalog/Research Areas/Epigenetics, Root Catalog/Research Areas/Acetylation, Root Catalog/Research Areas/Transcription Factors, Root Catalog/Products/Polyclonal Antibodies/Trial Size Polyclonal Antibodies, Root Catalog/Products/Primary Antibodies, Root Catalog/Products/Aviva Rabbit Polyclonal
Shipping Temperature	Wet Ice
Molecular Weight	125kDa
Species Tested	Mouse
Gene symbol	SREBF1
Gene Fullname	Sterol regulatory element binding transcription factor 1
Protein size	1134
Product format	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and storage	For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Partner proteins	Rnf20; Zbtb7c; Ppargc1b; Rela; Ewsr1; Pcbd1;
Description of target	Srebf1 is transcriptional activator that binds to the sterol regulatory element 1 (SRE-1) (5'-ATCACCCCAC-3'). Srebf1 also binds to an E-box motif (5'-ATCACGTGA-3'). Srebf1 regulates the transcription of genes for sterol biosynthesis and the LDL receptor gene.
Nucleotide accession_num	NM_011480
Protein accession_num	NP_035610
Protein name	Sterol regulatory element-binding protein 1
Clonality	Polyclonal
Purification	Affinity Purified
Immunogen	The immunogen is a synthetic peptide directed towards the N terminal region of mouse SREBF1
Homology	Mouse: 100%; Rat: 93%
Concentration	0.5 mg/ml

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

Produkt-Datenblatt anfordern

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 25 ul

lieferbar

Lieferung vsl. bis 30.10.2025

Express-Lieferung: 3 Tage sparen

Vergleichen

Auf den Wunschzettel

Angebot anfordern