« Zurück
Startseite /
TSG101 Antibody - middle region

TSG101 Antibody - middle region

ArtNr	ARP37310_T100-25UL
Hersteller	AVIVA Systems Biology
Menge	25 ul
Kategorie	Oncology Antibodies Immunohistochemistry Western Blot Primary Antibodies By Organ Breast Cancer
Typ	Antibody Polyclonal
Format	Liquid
Applikationen	WB, IHC
Specific against	Human (Homo sapiens), Mouse (Murine, Mus musculus), Rat (Rattus norvegicus), Rabbit (Oryctolagus cuniculus), Guinea Pig, Goat (Caprine, Capra aegagrus hircus), Dog (Canine, Canis lupus familiaris), Horse (Equine), Cow (Bos taurus)
Host	Rabbit
Sequence	RSELLELIQIMIVIFGEEPPVFSRPTVSASYPPYTATGPPNTSYMPGMPS
Citations	Isolation of Exosomes and Microvesicles from Cell Culture Systems to Study Prion Transmission. Methods Mol. Biol. 1545, 153-176 (2017). 27943213 Stefan,M., (er) BMC Genomics 6, 157 (2005)
ECLASS 10.1	32160702
ECLASS 11.0	32160702
UNSPSC	12352203
Alias	CC2,AI255943
Versandbedingung	Gekühlt
Lieferbar
Manufacturer - Type	Polyclonal Antibody
Manufacturer - Category	Root Catalog/Products/Polyclonal Antibodies, Root Catalog/Products/Polyclonal Antibodies/RNA Binding Proteins, Root Catalog/Products/Polyclonal Antibodies/Growth Factors & Hormones, Root Catalog/Research Areas/Developmental Biology, Root Catalog/Research Areas/Immunohistochemistry, Root Catalog/Research Areas/Transcription Factors, Root Catalog/Research Areas/Cell Differentiation, Root Catalog/Products/Polyclonal Antibodies/Trial Size Polyclonal Antibodies, Root Catalog/Products/Primary Antibodies, Root Catalog/Products/Aviva Rabbit Polyclonal
Shipping Temperature	Wet Ice
Molecular Weight	43kDa
Species Tested	Mouse
Gene symbol	TSG101
Gene Fullname	Tumor susceptibility gene 101
Protein size	391
Product format	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and storage	For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Partner proteins	Nr3c2; Ndfip1; SH3KBP1; Ppp1cc; Gjd3; Gjb3; Gjc1; Gja1; Ubc; Mgrn1; Tsg101; Nfe2; Ikbkg; Gmcl1;
Description of target	TSG101 has a direct role in the control of growth and differentiation in primary epithelial cells. It is required for normal cell function of embryonic and adult tissues but that this gene is not a tumor suppressor for sporadic forms of breast cancer.
Nucleotide accession_num	NM_021884
Protein accession_num	NP_068684
Protein name	Tumor susceptibility gene 101 protein
Clonality	Polyclonal
Purification	Protein A purified
Immunogen	The immunogen is a synthetic peptide corresponding to a region of Mouse
Homology	Cow: 93%; Dog: 86%; Goat: 93%; Guinea Pig: 93%; Horse: 79%; Human: 79%; Mouse: 100%; Rabbit: 79%; Rat: 100%
Concentration	1.0 mg/ml

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

Produkt-Datenblatt anfordern

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 25 ul

lieferbar

Lieferung vsl. bis 30.10.2025

Express-Lieferung: 2 Tage sparen

Vergleichen

Auf den Wunschzettel

Angebot anfordern