« Zurück
Startseite /
SMARCA1 Antibody - N-terminal region

SMARCA1 Antibody - N-terminal region

ArtNr	ARP37435_T100-25UL
Hersteller	AVIVA Systems Biology
Menge	25 ul
Kategorie	Oncology Neuroscience Neural Lineage Markers Antibodies By Cell Type Blastoma Carcinoma Hematology Lymphoma Melanoma Sarcoma Immunoprecipitation Western Blot Primary Antibodies CHiP
Typ	Antibody Polyclonal
Format	Liquid
Applikationen	WB, CHIP
Specific against	Mouse (Murine, Mus musculus), Rat (Rattus norvegicus)
Host	Rabbit
Sequence	VAVSDARATVVVVEDEQPGPSTFKEEGAAAAATEGTTATEKGEKKEKITS
Citations	Okazaki,Y., et al., (2002) Nature 420 (6915), 563-573
ECLASS 10.1	32160702
ECLASS 11.0	32160702
UNSPSC	12352203
Alias	Sn,Snf2l,5730494M04Rik
Versandbedingung	Gekühlt
Lieferbar
Manufacturer - Type	Polyclonal Antibody
Manufacturer - Category	Root Catalog/Products/Polyclonal Antibodies, Root Catalog/Products/Polyclonal Antibodies/Transcription Factor, Root Catalog/Products/Polyclonal Antibodies/Various, Root Catalog/Research Areas/Chromatin Immunoprecipitation, Root Catalog/Research Areas/Transcription Factors, Root Catalog/Products/Polyclonal Antibodies/Trial Size Polyclonal Antibodies, Root Catalog/Products/Primary Antibodies, Root Catalog/Products/Aviva Rabbit Polyclonal
Shipping Temperature	Wet Ice
Molecular Weight	43kDa
Species Tested	Mouse
Gene symbol	SMARCA1
Gene Fullname	SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily a, member 1
Protein size	381
Product format	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and storage	For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Partner proteins	Eed; Ewsr1; Baz1a;
Description of target	cDNA library was prepared and sequenced in Mouse Genome Encyclopedia Project of Genome Exploration Research Group in Riken Genomic Sciences Center and Genome Science Laboratory in RIKEN.
Nucleotide accession_num	NM_053123
Protein accession_num	BAC28931
Protein name	Probable global transcription activator SNF2L1 Ensembl ENSMUSP00000135570
Clonality	Polyclonal
Purification	Protein A purified
Immunogen	The immunogen is a synthetic peptide directed towards the N terminal region of mouse SMARCA1
Homology	Mouse: 100%; Rat: 100%
Concentration	1.0 mg/ml

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

Produkt-Datenblatt anfordern

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 25 ul

lieferbar

Lieferung vsl. bis 30.10.2025

Express-Lieferung: 2 Tage sparen

Vergleichen

Auf den Wunschzettel

Angebot anfordern