« Zurück
Startseite /
POU2F1 Antibody - C-terminal region

POU2F1 Antibody - C-terminal region

ArtNr	ARP37619_T100-25UL
Hersteller	AVIVA Systems Biology
Menge	25 ul
Kategorie	Metabolism Diabetes Glucose Homeostasis Antibodies Obesity Western Blot Primary Antibodies
Typ	Antibody Polyclonal
Format	Liquid
Applikationen	WB
Specific against	Mouse (Murine, Mus musculus)
Host	Rabbit
Sequence	VTSSTATTLTVNPVLPLTSAAVTNLSLTGKQQPAYRLVSTVPVRFLWRTA
Citations	Gupta, S. et al. Human organic cation transporter 1 is expressed in lymphoma cells and increases susceptibility to irinotecan and paclitaxel. J. Pharmacol. Exp. Ther. 341, 16-23 (2012). 22202118 Tantin,D., et al., (2005) Cancer Res. 65 (23), 10750-10758
ECLASS 10.1	32160702
ECLASS 11.0	32160702
UNSPSC	12352203
Alias	Oct,Otf,Oct-,Oct1,Otf-,Otf1,NF-A1,Oct-1,Otf-1,2810482H01Rik
Versandbedingung	Gekühlt
Lieferbar
Manufacturer - Type	Polyclonal Antibody
Manufacturer - Category	Root Catalog/Products/Polyclonal Antibodies, Root Catalog/Products/Polyclonal Antibodies/Transcription Factor, Root Catalog/Research Areas/DNA\/RNA\/Protein Interactions, Root Catalog/Research Areas/Transcription Factors, Root Catalog/Products/Polyclonal Antibodies/Trial Size Polyclonal Antibodies, Root Catalog/Products/Primary Antibodies, Root Catalog/Products/Aviva Rabbit Polyclonal
Shipping Temperature	Wet Ice
Molecular Weight	57kDa
Species Tested	Mouse
Gene symbol	POU2F1
Gene Fullname	POU domain, class 2, transcription factor 1
Protein size	522
Product format	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and storage	For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Partner proteins	Nf1; Brca1; Atf2; Tle4; Msx1; Aes; Prdm5; Polr1a; Pou2f1; Irf9; Hoxc4; Hoxb8; Hoxa9; Hoxa6; Nr3c1; Ar;
Description of target	POU2F1 is a member of the POU family that represents the double-stranded DNA binding proteins specifically binding to the block C region.
Nucleotide accession_num	NM_198932
Protein accession_num	NP_945150
Protein name	POU domain, class 2, transcription factor 1
Clonality	Polyclonal
Purification	Protein A purified
Immunogen	The immunogen is a synthetic peptide directed towards the C terminal region of mouse POU2F1
Homology	Mouse: 100%
Concentration	1.0 mg/ml

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

Produkt-Datenblatt anfordern

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 25 ul

lieferbar

Lieferung vsl. bis 30.10.2025

Express-Lieferung: 3 Tage sparen

Vergleichen

Auf den Wunschzettel

Angebot anfordern