Atf4 Antibody - N-terminal region

ArtNr	ARP38066_P050-25UL
Hersteller	AVIVA Systems Biology
Menge	25 ul
Kategorie	Oncology Neuroscience Neural Lineage Markers Aging & Neurological Disorders Neural Signaling Antibodies Immunohistochemistry Western Blot Primary Antibodies By Organ Lymphatic System Cancer Neuronal Cell Markers
Typ	Antibody Polyclonal
Format	Liquid
Applikationen	WB, IHC-P
Specific against	Human (Homo sapiens), Mouse (Murine, Mus musculus), Rat (Rattus norvegicus), Guinea Pig, Sheep (Ovine, Ovis aries), Dog (Canine, Canis lupus familiaris), Cow (Bos taurus)
Host	Rabbit
Sequence	VLAGDLMSPFDQSGLGAEESLGLLDDYLEVAKHLKPHGFSSDKAGSSEWP
Citations	Kalinec, G. M. et al. Acetaminophen and NAPQI are toxic to auditory cells via oxidative and endoplasmic reticulum stress-dependent pathways. Hear. Res. 313, 26-37 (2014). 24793116
ECLASS 10.1	32160702
ECLASS 11.0	32160702
UNSPSC	12352203
Alias	Atf-,C/AT,CREB,Atf-4,C/ATF,CREB2,CREB-2,TAXREB,TAXREB67
Versandbedingung	Gekühlt
Lieferbar
Manufacturer - Type	Polyclonal Antibody
Manufacturer - Category	Root Catalog/Products/Polyclonal Antibodies, Root Catalog/Products/Polyclonal Antibodies/Transcription Factor, Root Catalog/Research Areas/Cell Biology, Root Catalog/Products/Polyclonal Antibodies/Various, Root Catalog/Research Areas/Transcription Factors, Root Catalog/Products/Polyclonal Antibodies/Trial Size Polyclonal Antibodies, Root Catalog/Products/Primary Antibodies, Root Catalog/Products/Aviva Rabbit Polyclonal
Shipping Temperature	Wet Ice
Molecular Weight	38kDa
Species Tested	Mouse
Gene symbol	ATF4
Gene Fullname	Activating transcription factor 4
Protein size	349
Product format	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and storage	For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Partner proteins	Egln3; Ubc; Hif1a; Satb2; Fam175b; Trib3; Gabbr2; Gabbr1; Jun; Fos; Dapk3; Rps6ka3; Tnfsf11; Prkaca;
Description of target	The function of Atf4 remains unknown.
Nucleotide accession_num	NM_009716
Protein accession_num	NP_033846
Protein name	Cyclic AMP-dependent transcription factor ATF-4
Clonality	Polyclonal
Purification	Affinity Purified
Immunogen	The immunogen is a synthetic peptide corresponding to a region of Mouse
Homology	Cow: 86%; Dog: 100%; Guinea Pig: 93%; Human: 100%; Mouse: 92%; Rat: 100%; Sheep: 93%
Concentration	0.5 mg/ml

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

Produkt-Datenblatt anfordern

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 25 ul

lieferbar

Lieferung vsl. bis 30.10.2025

Express-Lieferung: 2 Tage sparen

Vergleichen

Auf den Wunschzettel

Angebot anfordern