« Zurück
Startseite /
Hoxb1 Antibody - N-terminal region

Hoxb1 Antibody - N-terminal region

ArtNr	ARP38113_P050-25UL
Hersteller	AVIVA Systems Biology
Menge	25 ul
Kategorie	Neuroscience Neural Transcription Factors Antibodies Western Blot Primary Antibodies
Typ	Antibody Polyclonal
Format	Liquid
Applikationen	WB
Specific against	Human (Homo sapiens), Mouse (Murine, Mus musculus), Rat (Rattus norvegicus), Dog (Canine, Canis lupus familiaris), Horse (Equine), Pig (Porcine, Sus scrofa domesticus), Cow (Bos taurus)
Host	Rabbit
Sequence	AYSAPTSFPPSSAPAVDSYAGESRYGGGLPSSALQQNSGYPVQQPPSSLG
ECLASS 10.1	32160702
ECLASS 11.0	32160702
UNSPSC	12352203
Versandbedingung	Gekühlt
Lieferbar
Manufacturer - Type	Polyclonal Antibody
Manufacturer - Category	Root Catalog/Products/Polyclonal Antibodies, Root Catalog/Products/Polyclonal Antibodies/Various, Root Catalog/Products/Polyclonal Antibodies/Trial Size Polyclonal Antibodies, Root Catalog/Products/Primary Antibodies, Root Catalog/Products/Aviva Rabbit Polyclonal
Shipping Temperature	Wet Ice
Molecular Weight	32kDa
Species Tested	Rat
Gene symbol	HOXB1
Gene Fullname	homeobox B1
Protein size	297
Product format	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and storage	For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Description of target	The function of this protein remains unknown.
Protein accession_num	XP_220896
Protein name	Homeobox protein Hox-B1
Clonality	Polyclonal
Purification	Affinity Purified
Immunogen	The immunogen is a synthetic peptide directed towards the N-terminal region of Rat Hoxb1
Homology	Cow: 79%; Dog: 86%; Horse: 86%; Human: 100%; Mouse: 79%; Pig: 93%; Rat: 86%
Concentration	0.5 mg/ml

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

Produkt-Datenblatt anfordern

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 25 ul

lieferbar

Lieferung vsl. bis 30.10.2025

Express-Lieferung: 2 Tage sparen

Vergleichen

Auf den Wunschzettel

Angebot anfordern