« Zurück
Startseite /
MZF1 Antibody - N-terminal region

MZF1 Antibody - N-terminal region

ArtNr	ARP38321_P050-25UL
Hersteller	AVIVA Systems Biology
Menge	25 ul
Kategorie	Neuroscience Aging & Neurological Disorders Neural Epigenetics Antibodies Western Blot Primary Antibodies
Typ	Antibody Polyclonal
Format	Liquid
Applikationen	WB
Specific against	Human (Homo sapiens), Dog (Canine, Canis lupus familiaris), Horse (Equine)
Host	Rabbit
Sequence	RPAVLGSPDRAPPEDEGPVMVKLEDSEEEGEAALWDPGPEAARLRFRCFR
Citations	Dong,S., (2008) J. Invest. Dermatol. 128 (3), 549-557
ECLASS 10.1	32160702
ECLASS 11.0	32160702
UNSPSC	12352203
Alias	MZF-1,MZF1B,ZFP98,ZNF42,ZSCAN6
Versandbedingung	Gekühlt
Lieferbar
Manufacturer - Type	Polyclonal Antibody
Manufacturer - Category	Root Catalog/Products/Polyclonal Antibodies, Root Catalog/Products/Polyclonal Antibodies/Transcription Regulation, Root Catalog/Research Areas/Developmental Biology, Root Catalog/Research Areas/Transcription Factors, Root Catalog/Products/Polyclonal Antibodies/Trial Size Polyclonal Antibodies, Root Catalog/Products/Primary Antibodies, Root Catalog/Products/Aviva Rabbit Polyclonal
Shipping Temperature	Wet Ice
Molecular Weight	82kDa
Species Tested	Human
Gene symbol	MZF1
Gene Fullname	Myeloid zinc finger 1
Protein size	734
Product format	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and storage	For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Partner proteins	CDK6; CDK4; SUMO1; ZNF202; ZNF174; ZNF24; SCAND1; FHL3; LDOC1; MZF1;
Description of target	MZF1 belongs to the krueppel C2H2-type zinc-finger protein family. It contains 13 C2H2-type zinc fingers and 1 SCAN box domain. MZF1 may be one regulator of transcriptional events during hemopoietic development.
Nucleotide accession_num	NM_003422
Protein accession_num	NP_003413
Protein name	Myeloid zinc finger 1
Clonality	Polyclonal
Purification	Affinity Purified
Immunogen	The immunogen is a synthetic peptide directed towards the N terminal region of human MZF1
Homology	Dog: 100%; Horse: 92%; Human: 100%
Concentration	0.5 mg/ml
Sample Type Confirmation	MZF1 is supported by BioGPS gene expression data to be expressed in Jurkat

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

Produkt-Datenblatt anfordern

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 25 ul

lieferbar

Lieferung vsl. bis 30.10.2025

Express-Lieferung: 2 Tage sparen

Vergleichen

Auf den Wunschzettel

Angebot anfordern