FOXH1 Antibody - N-terminal region

ArtNr	ARP38405_P050-25UL
Hersteller	AVIVA Systems Biology
Menge	25 ul
Kategorie	Oncology Neuroscience Neural Lineage Markers Targets for Rodent Neurosciences Antibodies Western Blot Primary Antibodies By Organ Colorectal Cancer Neurodegeneration Markers
Typ	Antibody Polyclonal
Format	Liquid
Applikationen	WB
Specific against	Human (Homo sapiens), Rat (Rattus norvegicus), Rabbit (Oryctolagus cuniculus), Guinea Pig, Horse (Equine), Pig (Porcine, Sus scrofa domesticus), Cow (Bos taurus)
Host	Rabbit
Sequence	MGPCSGSRLGPPEAESPSQPPKRRKKRYLRHDKPPYTYLAMIALVIQAAP
ECLASS 10.1	32160702
ECLASS 11.0	32160702
UNSPSC	12352203
Alias	FAST1,FAST-1
Versandbedingung	Gekühlt
Lieferbar
Manufacturer - Type	Polyclonal Antibody
Manufacturer - Category	Root Catalog/Products/Polyclonal Antibodies, Root Catalog/Products/Polyclonal Antibodies/Transcription Factor, Root Catalog/Research Areas/Cell Biology, Root Catalog/Research Areas/Immunology, Root Catalog/Research Areas/Transcription Factors, Root Catalog/Products/Polyclonal Antibodies/Trial Size Polyclonal Antibodies, Root Catalog/Products/Primary Antibodies, Root Catalog/Products/Aviva Rabbit Polyclonal
Shipping Temperature	Wet Ice
Molecular Weight	39kDa
Species Tested	Human
Gene symbol	FOXH1
Gene Fullname	Forkhead box H1
Protein size	365
Product format	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and storage	For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Partner proteins	ELAC2; SMAD2; TCF12; TCF3; SMAD3; FOXG1; DRAP1; SMAD4; NKX2-5; TGIF1;
Description of target	FOXH1 encodes a human homolog of Xenopus forkhead activin signal transducer-1. FOXH1 protein binds SMAD2 and activates an activin response element via binding the DNA motif TGT(G/T)(T/G)ATT.
Nucleotide accession_num	NM_003923
Protein accession_num	NP_003914
Protein name	Forkhead box protein H1
Clonality	Polyclonal
Purification	Affinity Purified
Immunogen	The immunogen is a synthetic peptide directed towards the N terminal region of human FOXH1
Homology	Cow: 86%; Guinea Pig: 79%; Horse: 92%; Human: 100%; Pig: 83%; Rabbit: 79%; Rat: 79%
Concentration	0.5 mg/ml

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

Produkt-Datenblatt anfordern

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 25 ul

lieferbar

Lieferung vsl. bis 30.10.2025

Express-Lieferung: 2 Tage sparen

Vergleichen

Auf den Wunschzettel

Angebot anfordern