« Zurück
Startseite /
CBFA2T3 Antibody - N-terminal region

CBFA2T3 Antibody - N-terminal region

ArtNr	ARP38578_T100-25UL
Hersteller	AVIVA Systems Biology
Menge	25 ul
Kategorie	Oncology Neuroscience Neural Lineage Markers Molecular Targets for Neuroscience Targets for Rodent Neurosciences Aging & Neurological Disorders Neural Epigenetics Neural Development Antibodies By Cell Type Carcinoma Hematology Leukemia Lymphoma Melanoma Sarcoma Western Blot Primary Antibodies By Organ Breast Cancer Cytoskeleton Markers
Typ	Antibody Polyclonal
Format	Liquid
Applikationen	WB
Specific against	Human (Homo sapiens)
Host	Rabbit
Sequence	MPASRLRDRAASSASGSTCGSMSQTHPVLESGLLASAGCSAPRGPRKGGP
ECLASS 10.1	32160702
ECLASS 11.0	32160702
UNSPSC	12352203
Alias	ETO2,MTG16,MTGR2,ZMYND4,RUNX1T3
Versandbedingung	Gekühlt
Lieferbar
Manufacturer - Type	Polyclonal Antibody
Manufacturer - Category	Root Catalog/Products/Polyclonal Antibodies, Root Catalog/Products/Polyclonal Antibodies/Transcription Factor, Root Catalog/Products/Polyclonal Antibodies/Transcription Regulation, Root Catalog/Research Areas/Stem Cells, Root Catalog/Research Areas/Transcription Factors, Root Catalog/Research Areas/Cell Differentiation, Root Catalog/Products/Polyclonal Antibodies/Trial Size Polyclonal Antibodies, Root Catalog/Products/Primary Antibodies, Root Catalog/Products/Aviva Rabbit Polyclonal, Root Catalog/Research Areas/Cancer/Cancer Transcription Factor
Shipping Temperature	Wet Ice
Molecular Weight	60kDa
Species Tested	Human
Gene symbol	CBFA2T3
Gene Fullname	Core-binding factor, runt domain, alpha subunit 2; translocated to, 3
Protein size	545
Product format	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and storage	For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Partner proteins	Zbtb38; Zbtb4; ZBTB33; GMEB2; SEC24A; MATN2; ZBTB47; UBC; RUNX1; TAL1; TRIM33; SIN3B; NCOR1; HDAC3; CBFA2T3; CBFA2T2; HDAC1; PRKAR2A; RUNX1T1; LDB1; TCF3; HDAC8; HDAC6; HDAC2;
Description of target	The t(16; 21)(q24; q22) translocation is a rare but recurrent chromosomal abnormality associated with therapy-related myeloid malignancies. The translocation produces a chimeric gene made up of the 5'-region of the AML1 gene fused to the 3'-region of CBFA2T3. In addition, CBFA2T3 is a putative breast tumor suppressor.
Nucleotide accession_num	NM_005187
Protein accession_num	BAA31276
Protein name	Protein CBFA2T3
Clonality	Polyclonal
Purification	Protein A purified
Immunogen	The immunogen is a synthetic peptide directed towards the N terminal region of human CBFA2T3
Homology	Human: 100%
Concentration	1.0 mg/ml
Sample Type Confirmation	CBFA2T3 is supported by BioGPS gene expression data to be expressed in Jurkat

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

Produkt-Datenblatt anfordern

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 25 ul

lieferbar

Lieferung vsl. bis 30.10.2025

Express-Lieferung: 2 Tage sparen

Vergleichen

Auf den Wunschzettel

Angebot anfordern