« Zurück
Startseite /
Foxo4 Antibody - C-terminal region

Foxo4 Antibody - C-terminal region

ArtNr	ARP38710_P050-25UL
Hersteller	AVIVA Systems Biology
Menge	25 ul
Kategorie	Oncology Metabolism Diabetes Cholesterol & Lipid Metabolism Regulation of Appetite Antibodies By Cell Type Carcinoma Western Blot Primary Antibodies By Organ Skin Cancer
Typ	Antibody Polyclonal
Format	Liquid
Applikationen	WB
Specific against	Human (Homo sapiens), Mouse (Murine, Mus musculus), Rat (Rattus norvegicus), Rabbit (Oryctolagus cuniculus), Guinea Pig, Dog (Canine, Canis lupus familiaris), Horse (Equine), Cow (Bos taurus)
Host	Rabbit
Sequence	PPVMAGAPIPKVLGTPVLASPTEDSSHDRMPQDLDLDMYMENLECDMDNI
ECLASS 10.1	32160702
ECLASS 11.0	32160702
UNSPSC	12352203
Alias	af,Fox,Mll,afx,Afxh,Mllt7
Versandbedingung	Gekühlt
Lieferbar
Manufacturer - Type	Polyclonal Antibody
Manufacturer - Category	Root Catalog/Products/Polyclonal Antibodies, Root Catalog/Products/Polyclonal Antibodies/RNA Binding Proteins, Root Catalog/Products/Polyclonal Antibodies/Lymphocyte Signaling, Root Catalog/Research Areas/Cell Biology, Root Catalog/Research Areas/Chromatin & Nuclear Signaling, Root Catalog/Research Areas/Immunology, Root Catalog/Research Areas/E3 & Ubiquitin, Root Catalog/Research Areas/Acetylation, Root Catalog/Research Areas/Transcription Factors, Root Catalog/Research Areas/Cell Differentiation, Root Catalog/Products/Polyclonal Antibodies/Trial Size Polyclonal Antibodies, Root Catalog/Products/Primary Antibodies, Root Catalog/Products/Aviva Rabbit Polyclonal
Shipping Temperature	Wet Ice
Molecular Weight	54kDa
Species Tested	Mouse
Gene symbol	FOXO4
Gene Fullname	Forkhead box O4
Protein size	505
Product format	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and storage	For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Description of target	Foxo4 is a transcription factor involved in the regulation of the insulin signaling pathway. It binds to insulin-response elements (IREs) and can activate transcription of IGFBP1. It down-regulates expression of HIF1A and suppresses hypoxia-induced transcriptional activation of HIF1A-modulated genes. It is also involved in negative regulation of the cell cycle. It represses smooth muscle cell differentiation by inhibiting the transcriptional coactivator activity of myocardin.
Nucleotide accession_num	NM_001005872
Protein accession_num	NP_001005872
Protein name	Histone acetyltransferase KAT5
Clonality	Polyclonal
Purification	Affinity Purified
Homology	Cow: 93%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%
Concentration	0.5 mg/ml

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

Produkt-Datenblatt anfordern

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 25 ul

lieferbar

Lieferung vsl. bis 30.10.2025

Express-Lieferung: 3 Tage sparen

Vergleichen

Auf den Wunschzettel

Angebot anfordern