« Zurück
Startseite /
Arntl2 Antibody - C-terminal region

Arntl2 Antibody - C-terminal region

ArtNr	ARP39399_P050-25UL
Hersteller	AVIVA Systems Biology
Menge	25 ul
Kategorie	Neuroscience Molecular Targets for Neuroscience Antibodies Cell Biology Cell Status Western Blot Senescence Primary Antibodies
Typ	Antibody Polyclonal
Format	Liquid
Applikationen	WB
Specific against	Human (Homo sapiens), Mouse (Murine, Mus musculus), Rat (Rattus norvegicus), Rabbit (Oryctolagus cuniculus), Dog (Canine, Canis lupus familiaris), Horse (Equine), Cow (Bos taurus)
Host	Rabbit
Sequence	PHGPLPGDSAQLGFDVLCDSDSIDMAAFMNYLEAEGGLGDPGDFSDIQWA
ECLASS 10.1	32160702
ECLASS 11.0	32160702
UNSPSC	12352203
Alias	MO,BMA,CLIF,MOP9,BMAL2,bHLHe,bHLHe6,4632430A05Rik
Versandbedingung	Gekühlt
Lieferbar
Manufacturer - Type	Polyclonal Antibody
Manufacturer - Category	Root Catalog/Products/Polyclonal Antibodies, Root Catalog/Products/Polyclonal Antibodies/Signaling Intermediate, Root Catalog/Products/Polyclonal Antibodies/Membrane Protein, Root Catalog/Research Areas/Transcription Factors, Root Catalog/Products/Polyclonal Antibodies/Trial Size Polyclonal Antibodies, Root Catalog/Products/Primary Antibodies, Root Catalog/Products/Aviva Rabbit Polyclonal
Shipping Temperature	Wet Ice
Molecular Weight	64kDa
Species Tested	Mouse
Gene symbol	ARNTL2
Gene Fullname	Aryl hydrocarbon receptor nuclear translocator-like 2
Protein size	579
Product format	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and storage	For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Description of target	ARNTL2/CLOCK heterodimers activate E-box element (3'-CACGTG-5') transcription. Also, in umbilical vein endothelial cells, activates SERPINE1 through E-box sites. This transactivation is inhibited by PER2 and CRY1.
Nucleotide accession_num	NM_172309
Protein accession_num	NP_758513
Protein name	Aryl hydrocarbon receptor nuclear translocator-like protein 2
Clonality	Polyclonal
Purification	Affinity Purified
Immunogen	The immunogen is a synthetic peptide corresponding to a region of Mouse
Homology	Cow: 100%; Dog: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 93%; Rat: 100%
Concentration	0.5 mg/ml

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

Produkt-Datenblatt anfordern

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 25 ul

lieferbar

Lieferung vsl. bis 30.10.2025

Express-Lieferung: 3 Tage sparen

Vergleichen

Auf den Wunschzettel

Angebot anfordern