« Zurück
Startseite /
ZNF335 Antibody - middle region

ZNF335 Antibody - middle region

ArtNr	ARP39540_P050-25UL
Hersteller	AVIVA Systems Biology
Menge	25 ul
Kategorie	Neuroscience Targets for Rodent Neurosciences Antibodies Western Blot Primary Antibodies
Typ	Antibody Polyclonal
Format	Liquid
Applikationen	WB
Specific against	Human (Homo sapiens), Rat (Rattus norvegicus), Rabbit (Oryctolagus cuniculus), Guinea Pig, Dog (Canine, Canis lupus familiaris), Horse (Equine), Cow (Bos taurus)
Host	Rabbit
Sequence	EAAAHSAVTAVADAAMAQAQGLFGTDETVPEHIQQLQHQGIEYDVITLAD
Citations	Garapaty,S., (2008) J. Biol. Chem. 283 (11), 6806-6816
ECLASS 10.1	32160702
ECLASS 11.0	32160702
UNSPSC	12352203
Alias	NIF1,NIF2,NIF-1,MCPH10
Versandbedingung	Gekühlt
Lieferbar
Manufacturer - Type	Polyclonal Antibody
Manufacturer - Category	Root Catalog/Products/Polyclonal Antibodies, Root Catalog/Research Areas/Chromatin & Nuclear Signaling, Root Catalog/Products/Polyclonal Antibodies/Various, Root Catalog/Research Areas/Epigenetics, Root Catalog/Research Areas/Transcription Factors, Root Catalog/Products/Polyclonal Antibodies/Trial Size Polyclonal Antibodies, Root Catalog/Products/Primary Antibodies, Root Catalog/Products/Aviva Rabbit Polyclonal
Shipping Temperature	Wet Ice
Molecular Weight	145kDa
Species Tested	Human
Gene symbol	ZNF335
Gene Fullname	Zinc finger protein 335
Protein size	1342
Product format	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and storage	For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Partner proteins	CDK6; CDK4; TFAP4; CCAR2; C11orf30; WDR5; ASH2L; RBBP5; HCFC1; NCOA6;
Description of target	ZNF335 enhances transcriptional activation by ligand-bound nuclear hormone receptors. However, it does this not by direct interaction with the receptor, but by direct interaction with the nuclear hormone receptor transcriptional coactivator NRC. ZNF335 may function by altering local chromatin structure.The protein encoded by this gene enhances transcriptional activation by ligand-bound nuclear hormone receptors. However, it does this not by direct interaction with the receptor, but by direct interaction with the nuclear hormone receptor transcriptional coactivator NRC. The encoded protein may function by altering local chromatin structure.
Nucleotide accession_num	NM_022095
Protein accession_num	NP_071378
Protein name	Zinc finger protein 335
Clonality	Polyclonal
Purification	Affinity Purified
Immunogen	The immunogen is a synthetic peptide directed towards the middle region of human ZNF335
Homology	Cow: 86%; Dog: 86%; Guinea Pig: 86%; Horse: 86%; Human: 100%; Rabbit: 93%; Rat: 86%
Concentration	0.5 mg/ml

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

Produkt-Datenblatt anfordern

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 25 ul

lieferbar

Lieferung vsl. bis 30.10.2025

Express-Lieferung: 1 Tage sparen

Vergleichen

Auf den Wunschzettel

Angebot anfordern