« Zurück
Startseite /
EYA1 Antibody - middle region

EYA1 Antibody - middle region

ArtNr	ARP39974_P050-25UL
Hersteller	AVIVA Systems Biology
Menge	25 ul
Kategorie	Neuroscience Neural Lineage Markers Molecular Targets for Neuroscience Targets for Rodent Neurosciences Aging & Neurological Disorders Neural Signaling Antibodies Immunohistochemistry Western Blot Primary Antibodies Glial Cell Markers Macrophage Markers
Typ	Antibody Polyclonal
Format	Liquid
Applikationen	WB
Specific against	Human (Homo sapiens), Mouse (Murine, Mus musculus), Rat (Rattus norvegicus), Rabbit (Oryctolagus cuniculus), Guinea Pig, Dog (Canine, Canis lupus familiaris), Horse (Equine), Zebrafish (Danio rerio), Cow (Bos taurus)
Host	Rabbit
Sequence	ERIIQRFGRKVVYVVIGDGVEEEQGAKKHAMPFWRISSHSDLMALHHALE
Citations	Suzuki,Y., (2004) Genome Res. 14 (9), 1711-1718
ECLASS 10.1	32160702
ECLASS 11.0	32160702
UNSPSC	12352203
Alias	BOP,BOR,BOS1,OFC1
Versandbedingung	Gekühlt
Lieferbar
Manufacturer - Type	Polyclonal Antibody
Manufacturer - Category	Root Catalog/Products/Polyclonal Antibodies, Root Catalog/Products/Polyclonal Antibodies/Transcription Factor, Root Catalog/Products/Polyclonal Antibodies/Various, Root Catalog/Research Areas/Disease Related, Root Catalog/Research Areas/Cell Structure, Root Catalog/Research Areas/DNA Repair, Root Catalog/Research Areas/Phosphorylation, Root Catalog/Research Areas/Sumoylation, Root Catalog/Research Areas/Transcription Factors, Root Catalog/Products/Polyclonal Antibodies/Trial Size Polyclonal Antibodies, Root Catalog/Products/Primary Antibodies, Root Catalog/Products/Aviva Rabbit Polyclonal
Shipping Temperature	Wet Ice
Molecular Weight	64kDa
Species Tested	Human
Gene symbol	EYA1
Gene Fullname	Eyes absent homolog 1 (Drosophila)
Protein size	592
Product format	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and storage	For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Partner proteins	GSK3B; FBXW7; UBC; FZR1; H2AFX; DACH1; SIX2; SIX3; SIX1; GNAI2; GNAZ;
Description of target	EYA1 is a member of the eyes absent (EYA) family of proteins. EYA1 may play a role in the developing kidney, branchial arches, eye, and ear. Mutations of this gene have been associated with branchiootorenal dysplasia syndrome, branchiootic syndrome, and s
Nucleotide accession_num	NM_153358
Protein accession_num	NP_742055
Protein name	Eyes absent homolog 1
Clonality	Polyclonal
Purification	Affinity Purified
Immunogen	The immunogen is a synthetic peptide directed towards the middle region of human EYA1
Homology	Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 92%
Concentration	0.5 mg/ml

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

Produkt-Datenblatt anfordern

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 25 ul

lieferbar

Lieferung vsl. bis 27.11.2025

Express-Lieferung: 1 Tage sparen

Vergleichen

Auf den Wunschzettel

Angebot anfordern