« Zurück
Startseite /
PRPS2 Antibody - middle region

PRPS2 Antibody - middle region

ArtNr	ARP41448_P050-25UL
Hersteller	AVIVA Systems Biology
Menge	25 ul
Kategorie	Metabolism Cholesterol & Lipid Metabolism Infectious Diseases Viral Infections Coronavirus (COVID-19) Antibodies Immunohistochemistry Western Blot Primary Antibodies
Typ	Antibody Polyclonal
Format	Liquid
Applikationen	WB, IHC
Specific against	Human (Homo sapiens), Mouse (Murine, Mus musculus), Rat (Rattus norvegicus), Rabbit (Oryctolagus cuniculus), Guinea Pig, Dog (Canine, Canis lupus familiaris), Horse (Equine), Zebrafish (Danio rerio), Cow (Bos taurus)
Host	Rabbit
Sequence	VSPDAGGAKRVTSIADRLNVEFALIHKERKKANEVDRMVLVGDVKDRVAI
Citations	Ishijima,S., (1997) Biochim. Biophys. Acta 1342 (1), 28-36
ECLASS 10.1	32160702
ECLASS 11.0	32160702
UNSPSC	12352203
Alias	PRSII
Versandbedingung	Gekühlt
Lieferbar
Manufacturer - Type	Polyclonal Antibody
Manufacturer - Category	Root Catalog/Products/Polyclonal Antibodies, Root Catalog/Research Areas/Tissue Specific & Cell Marker, Root Catalog/Research Areas/Immunohistochemistry, Root Catalog/Products/Polyclonal Antibodies/Trial Size Polyclonal Antibodies, Root Catalog/Products/Primary Antibodies, Root Catalog/Products/Aviva Rabbit Polyclonal
Shipping Temperature	Wet Ice
Molecular Weight	35kDa
Species Tested	Human
Gene symbol	PRPS2
Gene Fullname	Phosphoribosyl pyrophosphate synthetase 2
Protein size	318
Product format	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and storage	For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Partner proteins	NOTCH2NL; WDYHV1; PRPSAP1; PRPS2; PRPS1; FAM96A; SUMO2; UBC; ARMC9; GTF2I; BAG3; FN1; C18orf8; ELAVL1;
Description of target	The function remains unknown.
Nucleotide accession_num	NM_002765
Protein accession_num	NP_002756
Protein name	Ribose-phosphate pyrophosphokinase 2
Clonality	Polyclonal
Purification	Affinity Purified
Immunogen	The immunogen is a synthetic peptide directed towards the middle region of human PRPS2
Homology	Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 100%
Concentration	0.5 mg/ml

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

Produkt-Datenblatt anfordern

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 25 ul

lieferbar

Lieferung vsl. bis 30.10.2025

Express-Lieferung: 2 Tage sparen

Vergleichen

Auf den Wunschzettel

Angebot anfordern