« Zurück
Startseite /
CEACAM6 Antibody - N-terminal region

CEACAM6 Antibody - N-terminal region

ArtNr	ARP41503_P050-25UL
Hersteller	AVIVA Systems Biology
Menge	25 ul
Kategorie	Oncology Antibodies By Cell Type Carcinoma Hematology Leukemia Western Blot Primary Antibodies By Organ Lung Cancer Bladder Cancer Colorectal Cancer Breast Cancer Testicular & Prostate Cancer Gallbladder Cancer Gastric Cancer Pancreatic Cancer Thyroid Cancer
Typ	Antibody Polyclonal
Format	Liquid
Applikationen	WB
Specific against	Human (Homo sapiens), Guinea Pig
Host	Rabbit
Sequence	KLTIESTPFNVAEGKEVLLLAHNLPQNRIGYSWYKGERVDGNSLIVGYVI
Citations	Litkouhi,B., (2008) Gynecol. Oncol. 109 (2), 234-239
ECLASS 10.1	32160702
ECLASS 11.0	32160702
UNSPSC	12352203
Alias	NCA,CEAL,CD66c
Versandbedingung	Gekühlt
Lieferbar
Manufacturer - Type	Polyclonal Antibody
Manufacturer - Category	Root Catalog/Products/Polyclonal Antibodies, Root Catalog/Products/Polyclonal Antibodies/Various, Root Catalog/Research Areas/Disease Related, Root Catalog/Research Areas/Tissue Specific & Cell Marker, Root Catalog/Products/Polyclonal Antibodies/Trial Size Polyclonal Antibodies, Root Catalog/Products/Primary Antibodies, Root Catalog/Products/Aviva Rabbit Polyclonal
Shipping Temperature	Wet Ice
Molecular Weight	33kDa
Species Tested	Human
Gene symbol	CEACAM6
Gene Fullname	Carcinoembryonic antigen-related cell adhesion molecule 6 (non-specific cross reacting antigen)
Protein size	344
Product format	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and storage	For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Partner proteins	CARTPT; CEACAM6; CEACAM8; CEACAM7; CEACAM5; CEACAM1; APP;
Description of target	Many breast, pancreatic, colonic and non-small-cell lung carcinoma lines express CEACAM6 and CEACAM5, and antibodies to both can affect tumor cell growth in vitro and in vivo. CEACAM6 expression is elevated in many solid tumors, but variable as a function
Nucleotide accession_num	NM_002483
Protein accession_num	NP_002474
Protein name	Carcinoembryonic antigen-related cell adhesion molecule 6
Clonality	Polyclonal
Purification	Affinity Purified
Immunogen	The immunogen is a synthetic peptide directed towards the N terminal region of human CEACAM6
Homology	Guinea Pig: 79%; Human: 100%
Concentration	0.5 mg/ml

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

Produkt-Datenblatt anfordern

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 25 ul

lieferbar

Lieferung vsl. bis 26.02.2026

Express-Lieferung: 8 Tage sparen

Vergleichen

Auf den Wunschzettel

Angebot anfordern