« Zurück
Startseite /
SLC38A3 Antibody - N-terminal region

SLC38A3 Antibody - N-terminal region

ArtNr	ARP42323_P050-25UL
Hersteller	AVIVA Systems Biology
Menge	25 ul
Kategorie	Oncology Neuroscience Molecular Targets for Neuroscience Targets for Rodent Neurosciences Neural Signaling Antibodies Immunohistochemistry Western Blot Primary Antibodies By Organ Pancreatic Cancer Nervous System Cancer
Typ	Antibody Polyclonal
Format	Liquid
Applikationen	WB, IHC
Specific against	Human (Homo sapiens), Mouse (Murine, Mus musculus), Rat (Rattus norvegicus), Rabbit (Oryctolagus cuniculus), Guinea Pig, Sheep (Ovine, Ovis aries), Dog (Canine, Canis lupus familiaris), Horse (Equine), Pig (Porcine, Sus scrofa domesticus), Cow (Bos taurus)
Host	Rabbit
Sequence	GNQRVEDPARSCMEGKSFLQKSPSKEPHFTDFEGKTSFGMSVFNLSNAIM
Citations	Sidoryk,M., (2004) Neuroreport 15 (4), 575-578
ECLASS 10.1	32160702
ECLASS 11.0	32160702
UNSPSC	12352203
Alias	G17,SN1,NAT1,SNAT3
Versandbedingung	Gekühlt
Lieferbar
Manufacturer - Type	Polyclonal Antibody
Manufacturer - Category	Root Catalog/Products/Polyclonal Antibodies, Root Catalog/Products/Polyclonal Antibodies/Membrane Protein, Root Catalog/Products/Polyclonal Antibodies/Trial Size Polyclonal Antibodies, Root Catalog/Products/Polyclonal Antibodies/Enhanced Validation Polyclonal Antibodies, Root Catalog/Products/Primary Antibodies, Root Catalog/Products/Aviva Rabbit Polyclonal
Shipping Temperature	Wet Ice
Molecular Weight	56 kDa
Species Tested	Human, Mouse
Gene symbol	SLC38A3
Gene Fullname	Solute carrier family 38, member 3
Protein size	504
Product format	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and storage	For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Partner proteins	HMGN1; COL6A2; NEDD4; SETDB1;
Description of target	As a sodium-dependent amino acid/proton antiporter, SLC38A3 mediates electrogenic cotransport of glutamine and sodium ions in exchange for protons. It also recognizes histidine, asparagine and alanine. It may mediate amino acid transport in either direction under physiological conditions andÂ£Ãay play a role in nitrogen metabolism and synaptic transmission.
Nucleotide accession_num	NM_006841
Protein accession_num	NP_006832
Protein name	Sodium-coupled neutral amino acid transporter 3
Clonality	Polyclonal
Purification	Affinity Purified
Immunogen	The immunogen is a synthetic peptide directed towards the N terminal region of human SLC38A3
Homology	Cow: 100%; Dog: 93%; Guinea Pig: 86%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 100%; Rat: 100%; Sheep: 86%
Concentration	0.5 mg/ml
Sample Type Confirmation	SLC38A3 is supported by BioGPS gene expression data to be expressed in HepG2

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

Produkt-Datenblatt anfordern

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 25 ul

lieferbar

Lieferung vsl. bis 26.02.2026

Express-Lieferung: 8 Tage sparen

Vergleichen

Auf den Wunschzettel

Angebot anfordern