« Zurück
Startseite /
PLSCR1 Antibody - N-terminal region

PLSCR1 Antibody - N-terminal region

ArtNr	ARP57513_P050-25UL
Hersteller	AVIVA Systems Biology
Menge	25 ul
Kategorie	Oncology Neuroscience Neural Lineage Markers Metabolism Glucose Homeostasis Molecular Targets for Neuroscience Targets for Rodent Neurosciences Aging & Neurological Disorders Neural Signaling Protein Aggregation, Clearance & Misfolding Antibodies Immunohistochemistry Western Blot Primary Antibodies By Organ Heart & Blood Cancer Calcium Binding Protein Markers
Typ	Antibody Polyclonal
Format	Liquid
Applikationen	WB, IHC
Specific against	Human (Homo sapiens)
Host	Rabbit
Sequence	MDKQNSQMNASHPETNLPVGYPPQYPPTAFQGPPGYSGYPGPQVSYPPPP
ECLASS 10.1	32160702
ECLASS 11.0	32160702
UNSPSC	12352203
Alias	MMTRA1B
Versandbedingung	Gekühlt
Lieferbar
Manufacturer - Type	Polyclonal Antibody
Manufacturer - Category	Root Catalog/Products/Polyclonal Antibodies, Root Catalog/Products/Polyclonal Antibodies/Various, Root Catalog/Research Areas/Transcription Factors, Root Catalog/Products/Polyclonal Antibodies/Trial Size Polyclonal Antibodies, Root Catalog/Products/Primary Antibodies, Root Catalog/Products/Aviva Rabbit Polyclonal
Shipping Temperature	Wet Ice
Molecular Weight	35kDa
Species Tested	Human
Gene symbol	PLSCR1
Gene Fullname	Phospholipid scramblase 1
Protein size	318
Product format	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and storage	For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Partner proteins	PKD2; P2RY6; ILF3; EWSR1; ESR2; DOCK2; CTSZ; CATSPER1; LONRF1; KRTAP4-2; ZNF587; LINC01547; KRTAP9-2; GDPD5; SCNM1; DMRT3; VPS37C; PRR13; DEF6; LGALS9C; KRTAP4-11; KRTAP5-6; KRTAP10-3; KRTAP10-11; KRTAP10-9; LCE3C; LCE2D; TRIM42; BCL6B; LCE4A; ZNF417; MGA
Description of target	PLSCR1 may mediate accelerated ATP-independent bidirectional transbilayer migration of phospholipids upon binding calcium ions that results in a loss of phospholipid asymmetry in the plasma membrane.PLSCR1 may play a central role in the initiation of fibrin clot formation, in the activation of mast cells and in the recognition of apoptotic and injured cells by the reticuloendothelial system.
Nucleotide accession_num	NM_021105
Protein accession_num	NP_066928
Protein name	Phospholipid scramblase 1
Clonality	Polyclonal
Purification	Affinity Purified
Immunogen	The immunogen is a synthetic peptide directed towards the N terminal region of human PLSCR1
Homology	Human: 100%
Concentration	0.5 mg/ml
Sample Type Confirmation	PLSCR1 is strongly supported by BioGPS gene expression data to be expressed in HEK293T PLSCR1 is supported by BioGPS gene expression data to be expressed in 721_B

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

Produkt-Datenblatt anfordern

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 25 ul

lieferbar

Lieferung vsl. bis 26.02.2026

Express-Lieferung: 8 Tage sparen

Vergleichen

Auf den Wunschzettel

Angebot anfordern