« Zurück
Startseite /
PAM16 Antibody - C-terminal region

PAM16 Antibody - C-terminal region

ArtNr	ARP65133_P050-25UL
Hersteller	AVIVA Systems Biology
Menge	25 ul
Kategorie	Neuroscience Neural Mitochondrial Function Molecular Targets for Neuroscience Targets for Rodent Neurosciences Antibodies Western Blot Primary Antibodies
Typ	Antibody Polyclonal
Format	Liquid
Applikationen	WB
Specific against	Human (Homo sapiens), Mouse (Murine, Mus musculus), Rat (Rattus norvegicus), Dog (Canine, Canis lupus familiaris), Pig (Porcine, Sus scrofa domesticus)
Host	Rabbit
Sequence	NYEHLFKVNDKSVGGSFYLQSKVVRAKERLDEELKIQAQEDREKGQMPHT
ECLASS 10.1	32160702
ECLASS 11.0	32160702
UNSPSC	12352203
Alias	TIM16,MAGMAS,SMDMDM,TIMM16,CGI-136
Versandbedingung	Gekühlt
Lieferbar
Manufacturer - Type	Polyclonal Antibody
Manufacturer - Category	Root Catalog/Products/Polyclonal Antibodies, Root Catalog/Products/Polyclonal Antibodies/Various, Root Catalog/Products/Polyclonal Antibodies/Trial Size Polyclonal Antibodies, Root Catalog/Products/Primary Antibodies, Root Catalog/Products/Aviva Rabbit Polyclonal
Shipping Temperature	Wet Ice
Molecular Weight	14kDa
Species Tested	Human
Gene symbol	PAM16
Gene Fullname	Presequence translocase-associated motor 16 homolog (S. cerevisiae)
Protein size	125
Product format	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and storage	For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Partner proteins	ARL6IP1; UBC; EIF3C; BLOC1S2; MRFAP1; CEP70; PGRMC1; FEZ1; GPM6A; DNMT3B; TIM23; PAM18; DNAJC19; TIMM17A;
Description of target	PAM16 regulates ATP-dependent protein translocation into the mitochondrial matrix and inhibits DNAJC19 stimulation of HSPA9/Mortalin ATPase activity.
Subunit	TIM16
Nucleotide accession_num	NM_016069
Protein accession_num	NP_057153
Protein name	Mitochondrial import inner membrane translocase subunit TIM16
Clonality	Polyclonal
Purification	Affinity Purified
Homology	Dog: 86%; Human: 100%; Mouse: 86%; Pig: 79%; Rat: 93%
Concentration	0.5 mg/ml
Sample Type Confirmation	PAM16 is supported by BioGPS gene expression data to be expressed in HeLa, HepG2, Jurkat

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

Produkt-Datenblatt anfordern

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 25 ul

lieferbar

Lieferung vsl. bis 29.01.2026

Express-Lieferung: 14 Tage sparen

Vergleichen

Auf den Wunschzettel

Angebot anfordern