Vergleich

IL21R Antibody - middle region

ArtNr ARP79862_P050-25UL
Hersteller AVIVA Systems Biology
Menge 25 ul
Kategorie
Typ Antibody Polyclonal
Format Liquid
Applikationen WB
Specific against Human (Homo sapiens)
Host Rabbit
Sequence QLTELQEPAELVESDGVPKPSFWPTAQNSGGSAYSEERDRPYGLVSIDTV
ECLASS 10.1 32160702
ECLASS 11.0 32160702
UNSPSC 12352203
Alias NILR,CD360,IMD56
Versandbedingung Gekühlt
Lieferbar
Manufacturer - Type
Polyclonal Antibody
Manufacturer - Category
Root Catalog/Products/Polyclonal Antibodies, Root Catalog/Products/Polyclonal Antibodies/Signaling Intermediate, Root Catalog/Products/Polyclonal Antibodies/Growth Factors & Hormones, Root Catalog/Research Areas/Immunology, Root Catalog/Research Areas/Signal Transduction, Root Catalog/Research Areas/Meiosis\/Mitosis\/Cell Cycle, Root Catalog/Products/Polyclonal Antibodies/Trial Size Polyclonal Antibodies, Root Catalog/Products/Primary Antibodies, Root Catalog/Products/Aviva Rabbit Polyclonal
Shipping Temperature
Wet Ice
Molecular Weight
59 kDa
Species Tested
Human
Gene symbol
IL21R
Gene Fullname
interleukin 21 receptor
Protein size
238
Product format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and storage
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Description of target
The protein encoded by this gene is a cytokine receptor for interleukin 21 (IL21). It belongs to the type I cytokine receptors, and has been shown to form a heterodimeric receptor complex with the common gamma-chain, a receptor subunit also shared by the receptors for interleukin 2, 4, 7, 9, and 15. This receptor transduces the growth promoting signal of IL21, and is important for the proliferation and differentiation of T cells, B cells, and natural killer (NK) cells. The ligand binding of this receptor leads to the activation of multiple downstream signaling molecules, including JAK1, JAK3, STAT1, and STAT3. Knockout studies of a similar gene in mouse suggest a role for this gene in regulating immunoglobulin production. Three alternatively spliced transcript variants have been described.
Nucleotide accession_num
NM_021798.3
Protein accession_num
NP_068570.1
Protein name
interleukin-21 receptor
Clonality
Polyclonal
Purification
Affinity purified
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human IL21R
Concentration
0.5 mg/ml

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Menge: 25 ul
Lieferbar: In stock
lieferbar

Vergleichen

Auf den Wunschzettel

Angebot anfordern

Lieferzeit anfragen

Technische Frage stellen

Bulk-Anfrage stellen

Fragen zum Produkt?
 
Schließen