Vergleich

STK17A Antibody - C-terminal region

ArtNr AVARP02028_P050-25UL
Hersteller AVIVA Systems Biology
Menge 25 ul
Kategorie
Typ Antibody Polyclonal
Format Liquid
Applikationen WB
Specific against Guinea Pig, Dog (Canine, Canis lupus familiaris), Horse (Equine), Cow (Bos taurus)
Host Rabbit
Sequence KESIVTEELIVVTSYTLGQCRQSEKEKMEQKAISKRFKFEEPLLQEIPGE
Citations Sanjo,H., (1998) J. Biol. Chem. 273 (44), 29066-29071
ECLASS 10.1 32160702
ECLASS 11.0 32160702
UNSPSC 12352203
Alias DRAK1
Versandbedingung Gekühlt
Lieferbar
Manufacturer - Type
Polyclonal Antibody
Manufacturer - Category
Root Catalog/Products/Polyclonal Antibodies, Root Catalog/Products/Polyclonal Antibodies/Lymphocyte Signaling, Root Catalog/Research Areas/Chromatin & Nuclear Signaling, Root Catalog/Research Areas/Signal Transduction, Root Catalog/Research Areas/Apoptosis, Root Catalog/Research Areas/Phosphorylation, Root Catalog/Products/Polyclonal Antibodies/Trial Size Polyclonal Antibodies, Root Catalog/Products/Primary Antibodies, Root Catalog/Products/Aviva Rabbit Polyclonal
Shipping Temperature
Wet Ice
Molecular Weight
46kDa
Species Tested
Human
Gene symbol
STK17A
Gene Fullname
Serine/threonine kinase 17a
Protein size
414
Product format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and storage
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Partner proteins
UBC; STK17A;
Description of target
STK17A belongs to the protein kinase superfamily, CAMK Ser/Thr protein kinase family, DAP kinase subfamily. It contains 1 protein kinase domain. STK17A acts as a positive regulator of apoptosis.This gene is a member of the DAP kinase-related apoptosis-inducing protein kinase family and encodes an autophosphorylated nuclear protein with a protein kinase domain. The protein has apoptosis-inducing activity.
Nucleotide accession_num
NM_004760
Protein accession_num
NP_004751
Protein name
Serine/threonine-protein kinase 17A
Clonality
Polyclonal
Purification
Affinity Purified
Immunogen
The immunogen is a synthetic peptide directed towards the C terminal region of human STK17A
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 93%; Horse: 100%
Concentration
0.5 mg/ml

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Menge: 25 ul
Lieferbar: In stock
lieferbar

Vergleichen

Auf den Wunschzettel

Angebot anfordern

Lieferzeit anfragen

Technische Frage stellen

Bulk-Anfrage stellen

Fragen zum Produkt?
 
Schließen